KEGG   Azoarcus sp. KH32C: AZKH_2957Help
Entry
AZKH_2957         CDS       T02502                                 

Gene name
alaT
Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aza  Azoarcus sp. KH32C
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    AZKH_2957 (alaT)
   01230 Biosynthesis of amino acids
    AZKH_2957 (alaT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZKH_2957 (alaT)
   00290 Valine, leucine and isoleucine biosynthesis
    AZKH_2957 (alaT)
Enzymes [BR:aza01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AZKH_2957 (alaT)
    2.6.1.66  valine---pyruvate transaminase
     AZKH_2957 (alaT)
Amino acid related enzymes [BR:aza01007]
 Aminotransferase (transaminase)
  Class I
   AZKH_2957 (alaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3319539..3320840)
Genome map
AA seq 433 aa AA seqDB search
MSVEPKLRVASPLPETHSAPEAARAGAVVRKSAKLANVCYDIRGPVLTRAKQMEDEGHKI
MKLNIGNLAAFGFDAPEEIQMDMIRNLPNSAGYSDSKGIFAARKAIMHYTQQKHIKGVDI
EDIYIGNGVSELIVMAMNALLNAGDEVLVPAPDYPLWTAAVSLSGGTPVHYLCNEAEGWL
PDLEDMRARITPNTRAIVVINPNNPTGALYPDHILRGIVEIAREHGLILYADEVYDKVLY
DGEKHTSLASLSEDVLTIVFNGLSKNYRSCGYRAGWMVVCGDKRNAQDYIEGLNMLASMR
LCANVPGQYAIQTALGGYQSIDDLVSEGGRMRRQRDLAYELITEIPGVSCVKPKATLYMF
PRLDPKVYPIEDDQAFIAELLEEERVLLVQGTGFNWPHADHFRLVFLPHEDDLRDAIGRI
ARFLEHYRKRHGT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagcccaagctacgggtggcttcccctttacccgaaacgcattctgcgccg
gaagcggcgcgcgccggcgccgtagtccgcaagtccgcaaagctcgccaacgtctgctac
gacatccgcggcccggtcctgacgcgtgccaagcagatggaagacgaggggcacaagatc
atgaagctgaacatcggcaatcttgccgcgttcggcttcgacgcgcccgaagaaatccag
atggacatgatccggaatctgccgaattcggcaggttattccgattcgaagggcattttc
gccgcgcgcaaggcgatcatgcactacacccagcagaagcacatcaagggtgtggatatc
gaggatatctacatcggcaacggcgtgtccgagctgatcgtgatggcgatgaacgcgctg
ctcaatgccggcgacgaagtgctggtgccggcgcccgactatccgctgtggaccgcggcg
gtgagcctttccggcggcacgcccgtgcactacctgtgcaacgaggccgagggctggctg
cccgacctcgaggacatgcgtgcacgcatcacgccgaatacgcgcgcgatcgtcgtcatc
aacccgaacaacccgaccggcgcgctgtacccggaccacatcctgcgcggcatcgtcgag
atcgcgcgtgagcatggcctgatcctgtatgccgacgaggtctacgacaaggtgctgtac
gacggcgagaagcacacctcgctcgcctcgctgtctgaagacgtcctgacgatcgtgttc
aacggcctgtcgaagaactaccgttcgtgcggctaccgtgccggctggatggtcgtatgc
ggcgacaagcgcaatgcgcaggactacatcgagggactgaacatgctcgcctcgatgcgc
ctgtgcgcgaacgtccccggccagtatgcgatccagaccgcgctcggcggctaccagagc
atcgacgacctcgtcagtgagggcggccggatgcggcgccagcgcgatctggcgtacgaa
ctgatcaccgagatccccggcgtcagctgcgtgaagccgaaggcgacgctgtacatgttc
ccgcggctcgatccgaaggtctatccgatcgaggacgaccaggcctttatcgcagaactg
ctggaagaggagcgcgtgctgctcgtgcagggcaccggcttcaactggccgcatgcggac
cacttccggctggtgttcctgccgcacgaggacgacctgcgcgacgcgatcggccgtatc
gcccgcttcctcgagcattaccgaaagcgtcatggcacctga

DBGET integrated database retrieval system