KEGG   Azoarcus sp. KH32C: AZKH_2968Help
Entry
AZKH_2968         CDS       T02502                                 

Gene name
ligD
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aza  Azoarcus sp. KH32C
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aza00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AZKH_2968 (ligD)
Enzymes [BR:aza01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AZKH_2968 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3333659..3336214)
Genome map
AA seq 851 aa AA seqDB search
MLKSWAVPKGPSLDPSDKRLAVETEDHPYDYASFEGVIPPGHYGAGEVIVWDCGVYSPDE
GQEYWFHDRDEAQRRIREGLVKGKLSFTLRGEKLKGSFALVRSGEPRNWFLIKHKDRFAG
PADLMARNRSVLSGLAVEELKFLPAHRVPAATLAPTGRNEAMPAKLSPMLAETGEAPFSD
PDWLWEPKLDGYRVLAFVAGEEVKLQSRRGLDLTVTFPRLSDELRGQAADMILDGEVVAF
DASGRPSFNALQNRFQLKAERDIAAADRSTPVVFYCFDLLHFAGIDLRGAPYRDRRRYLA
QCLLPSPLLQLVHVAEDGEALQRAALASGFEGIIGKRKDSRYEAGRRSASWLKIKATQSG
EFVVGGYTRGKGSRGPLGALLLGYWDEGALRYASHVGSGFDAATLERVRARLEGLRTDVC
PFVEKPELNGPTTWVRPELVVEVQFQEWTADGSLRVPIFLRMRDDIDPKSVRRSKHGAVP
HKPPASGSASAEGGNSEIEDILQQLENSKTAFSLAVGPHRIRLTHLDRVYWPEDQALKQP
AVTKRDLLRYFAQVSPFLLPHLADRPLTLIRMPDGIFGQRFFQKRWEQERPEFLDMLDVY
SGHQDENHEVLICNNLATLLWLAQYGTIELHVWHSRARLGPDAAVQGTDYAGSLATLEAS
VLNYPDYVVFDLDPYIYSGKEAPGDEPELNTVAFEKGKEVAFWLRELLQSMALDAIVKTS
GKTGLHIFVPIRRTLDFDAARKVCELVGRHLLRLHPRDITMEWSVRSRTGKIFLDYNMNV
RGKTLNVAYSPRGVPGAPVSMPLTWDELASAHPLDFRITNVAQRLAQTGDRWHDALKRKL
SLERALSGAKT
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaaatcctgggcagttcccaagggaccgtcgctcgatccttcggacaagcggctg
gcggtcgagaccgaggatcacccttatgactacgcctccttcgagggggtcatcccgccc
ggtcattacggcgccggggaggtgattgtttgggactgcggtgtctattcgcccgacgag
gggcaggagtactggttccatgatcgggacgaagcgcagcgccggatccgtgaggggctt
gtgaagggcaagctcagctttacgctgcgaggggagaagctgaagggctcttttgccctt
gtgcgtagcggggagccgcgtaactggttcctgatcaagcacaaggaccgcttcgcggga
ccggcggacctcatggcgaggaaccgttcggtgcttagcgggttggcggtcgaggagctt
aagttcctgccggcccatcgggtgcccgcggcgacgctggcgcctaccggccggaacgag
gcgatgcccgcgaagctgtcgcccatgcttgcggagactggcgaggcgccgtttagcgat
cccgactggctgtgggagcccaagctcgatggctatcgcgtgctggccttcgtcgccggg
gaggaggtgaaactgcaatcgcgccggggcctcgacctgaccgtcactttccctcggctg
agcgacgagctgcgtggccaggcggcggacatgatcctggacggcgaggtcgtggccttc
gatgcgagcggccggccctcgttcaacgcgctgcagaatcgctttcagctgaaagccgag
cgggatattgccgcggccgatcggagcacaccggtggtcttttactgcttcgatctgctg
cacttcgccggcatcgatctgcggggagcgccttatcgcgaccgtcgccgctacctcgcg
caatgcctgctgccttcgcccctgctgcaactcgtccatgtcgcggaggatggggaggcg
ctgcagcgggctgcgctcgccagcggcttcgaggggatcatcggcaagcgcaaggacagc
cggtacgaggccgggcggcgctcggcatcctggctcaagatcaaggccactcaaagcggg
gagttcgtggttggcggctacacccgcggaaagggctcgcggggcccgctcggtgcgctg
ctgctcgggtactgggatgagggggcgctacgttatgcctcgcatgtcgggtccggcttc
gatgccgcaactctggagcgggtcagggcgcggctggagggcttacgaacggacgtgtgc
ccgttcgtggagaagccggagctgaatgggccgacgacttgggttagaccggaattggtg
gtcgaggtgcagttccaggaatggactgcggacggcagcctgcgtgtgccgatctttctc
cgtatgcgcgacgatatcgatcccaagtcggtacgccgtagcaagcacggcgcggtgccg
cataagccgcccgccagcgggtcggcgagcgcggagggtgggaacagcgagatcgaggac
atcctgcagcaactggagaacagcaagacagccttctcgctcgcggtcggtccgcaccgg
attcggctgacgcatctcgatcgcgtctactggccggaggatcaggccctcaagcagccg
gcggtgaccaagcgcgacctgctgcgctacttcgcgcaagtctcgcccttcctcctgcct
cacctcgcggatcgcccgctgacgctgattcgcatgcccgacggcatcttcggacagcgg
tttttccagaagcgctgggagcaggagcggccggaattcttggacatgctcgacgtgtat
tcggggcatcaggacgagaatcatgaagtgctcatctgcaacaacctggccacgctgctg
tggctggcgcagtatgggaccatcgagttgcatgtctggcattcgcgtgcgcgtctcggg
ccggatgcggcggtccagggaaccgactacgccggctcgctcgccaccctcgaggcgtcg
gtgctgaactaccccgactacgtggtgttcgacctcgatccgtacatctattccggcaag
gaggcgccgggagacgagccggaactcaatacggtcgccttcgagaagggcaaggaggtg
gccttttggctgcgcgagttgctgcagagtatggcgctggacgccatcgtcaagacctcg
ggcaagaccgggctacacatcttcgtgcccatccggcgcaccctcgatttcgatgccgcg
cgcaaggtgtgcgagctcgtcgggcggcacctgctgcgcctgcatccgcgggacatcacg
atggagtggagtgtgcggtcgcggaccggcaagatcttccttgactacaatatgaacgtc
cgcggcaagacgctgaacgtcgcctactcgccccgaggggtgcccggcgcaccggtgtcg
atgccgcttacttgggacgagctggccagcgcgcacccgctcgatttcaggatcaccaac
gtcgcgcagcgcctggcacagacgggtgatcgctggcacgacgccctgaagcgcaagctg
agcctggaacgggctttgtccggcgccaaaacctga

DBGET integrated database retrieval system