KEGG   Azoarcus sp. KH32C: AZKH_3930Help
Entry
AZKH_3930         CDS       T02502                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aza  Azoarcus sp. KH32C
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AZKH_3930 (fucA)
Enzymes [BR:aza01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AZKH_3930 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4359721..4360380
Genome map
AA seq 219 aa AA seqDB search
MTQGSHYDASLREELLATARAMTAAGLNTGTAGNVSVRMAGGMLITPSGMPPEACCVEDM
VFVAEDGTATGRLAPSSEWRFHHDIYAGRPEAGAVLHAHAPFATSLACQRTEIPAFHYMI
ARFGGNTVRCARYATFGTQDLSDNILDALEERSACLMANHGMLVFGRSLSNALALAIEFE
TLCEQYWRTRQLGEPVLLSDAEMAEVVERFRWYGKPQAG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacccagggcagccattacgacgcttcattgcgcgaggaattgctcgcgacggcgcgg
gcgatgactgccgccggactcaacacggggaccgccggcaatgtcagtgtgcggatggcg
ggcgggatgctgatcacgccgagcggcatgccaccggaggcgtgctgcgtcgaggacatg
gtgttcgtcgccgaggacgggacggcgacgggtcgtctcgcgccgtcgagcgagtggcgc
tttcaccacgacatctatgcggggcgccccgaggccggcgcggtcctgcacgcgcatgcc
ccgttcgcgacctcactcgcgtgccagcggaccgagatcccggccttccattacatgatc
gcgcgcttcggtggcaacacggtacgctgcgcgcgttatgcgaccttcggcacgcaggac
ctctccgacaacatcctcgatgcgctggaagagcgttcggcctgcctgatggcgaatcac
ggcatgctggtgttcggccgcagcctctcaaatgcgctggcgctcgcaatcgagttcgag
acgctgtgcgagcagtactggcgcacgcgccagctcggcgaaccggtgctgctgtcggac
gcggagatggccgaggtcgtcgagcgcttccgctggtacggcaagccgcaagcgggttaa

DBGET integrated database retrieval system