KEGG   Azoarcus sp. KH32C: AZKH_4228Help
Entry
AZKH_4228         CDS       T02502                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aza  Azoarcus sp. KH32C
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AZKH_4228 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZKH_4228 (rmlC)
Enzymes [BR:aza01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AZKH_4228 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4669484..4670029)
Genome map
AA seq 181 aa AA seqDB search
MKVVPTAIPDVLVIEPKVFGDARGFFFESFNARSFREATGLDEQFVQDNHSRSAQGVLRG
LHYQIRQPQGKLVRVVRGTVFDVAVDLRRHSPTFGRWVGIELSEHNHRQLWIPPGFAHGF
VVVSESADFLYKTTDYYAPEHERCLQWNDPTVGVEWPLAGEPQLSGKDRDGKPFAECEVF
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttcccaccgcgatccccgatgtgctcgtgatcgagcccaaagtgttcggc
gacgcgcgcggcttcttcttcgaaagcttcaacgcgcgcagcttccgtgaggcgaccggc
ctcgacgaacagttcgtacaggacaaccactcgcgctccgcacaaggcgtgctgcgcggc
ctgcactatcagatccgtcaaccccaagggaaactcgtgcgcgtcgtgcgcggcacggtg
ttcgacgtcgccgtcgatctgcgccgccattcaccgactttcggacgctgggtcggcatc
gagttgtcggaacataaccaccgccagctgtggatcccgcccggcttcgcacacggcttc
gtcgtcgtttccgagtcggcggatttcctctacaagaccaccgactactacgcccccgag
cacgaacgttgcctgcagtggaacgacccgaccgtcggcgtcgaatggccgctcgctggc
gagccgcaactgtccggcaaggatcgcgacggcaagccgttcgcggaatgcgaggtcttt
gaatga

DBGET integrated database retrieval system