KEGG   Azoarcus sp. KH32C: AZKH_p0512Help
Entry
AZKH_p0512        CDS       T02502                                 

Gene name
fdhA
Definition
formaldehyde dehydrogenase, glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
aza  Azoarcus sp. KH32C
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aza01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:aza00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:aza00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAZKH:complement(562433..563629)
Genome map
AA seq 398 aa AA seqDB search
MSENRGVVYLGQGHVEVQSIDYPKMVDPSGRAIGHGVILKVVTTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVVEIGRDVETLKIGDLVSVPFNVACGRCTTCKEQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDKDRAMEKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYIAGAGPVGMAAAGAARLLGAAVTIVGDMNPDRLAHARAVGFETVDLSLD
ASLGEQIAAILGTPEVDCAVDCVGFEAHGHGTHSHEEAPATVLNSLMEVTRVAGAIGIPG
LYVTDDPGAIDAAARRGNLSIRFGLGWAKSHSFHTGQTPVMKYNRNLMQAILWDRLPIAE
IVNVNVISLDEAPNGYRQFDGGAPRKFVLDPHGMLKAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaatcgcggtgttgtgtatctggggcaaggacatgtcgaagtgcaatccatc
gactatccaaagatggtcgatccgagcggtcgcgcgatcggccacggtgtcatccttaaa
gtagtgacaaccaatatttgcggctccgaccagcacatggtgcgcggccgcaccaccgcc
gaggtgggcctggtgcttggccacgagatcaccggcgaggtagtcgagatcggccgcgat
gtcgagacgctgaagatcggcgacctggtgtcggtgccgttcaacgtcgcctgcggccgc
tgcaccacatgtaaggagcagcacaccggggtgtgcctgaacgtgaacccgtcacgcgcc
ggcggcgcctacggctatgtcgacatgggcggctggatcggcggccaggccgagtacgtg
atggtgccgtacgccgatttcaacctgctgaaatttccggacaaggacagggcgatggag
aagatccgcgacctgacctgcctgtccgatattctgcccaccggctaccatggcgcggtg
accgccggggtgaaaccgggctcgaccgtctacatcgccggtgctggcccggtcggcatg
gccgccgccggcgcggcgaggctcctgggcgcggcggtgaccattgtcggcgacatgaac
ccggaccgcctcgcccacgcccgtgcagtcggtttcgagaccgtcgatctatccctcgac
gcgtcgctgggtgagcagatcgcggcgattctcgggaccccggaagtcgactgtgcggtc
gactgcgtcggcttcgaggcgcatggccacggtacccattcccacgaagaggcgccggcc
acggtcctcaattcgctgatggaggtcacccgcgtggccggcgccatcggaatcccgggc
ctgtacgtgaccgacgatccgggcgcgatcgacgctgcagccaggcgaggcaacctttcg
atccgcttcggcctcggctgggccaagtcccactccttccataccggccagaccccggtg
atgaagtacaaccgcaatctgatgcaggccatcctgtgggaccgcctgccgatcgccgag
atcgtgaacgtcaacgtgatctcgctggacgaggcgccgaacggttatcgccagtttgac
ggcggcgcgccgcgcaaattcgtcctcgacccgcacggcatgctcaaggcggcctga

DBGET integrated database retrieval system