KEGG   Azorhizobium caulinodans: AZC_0078Help
Entry
AZC_0078          CDS       T00609                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
azc  Azorhizobium caulinodans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_0078
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZC_0078
   00630 Glyoxylate and dicarboxylate metabolism
    AZC_0078
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZC_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(95251..96849)
Genome map
AA seq 532 aa AA seqDB search
MSTPALPSGVAITGAMAPRFEEILTSEALAFVAELHRTFNATRLALLAKRAERQARFDAG
ELPDFLPETKSVRDAEWTIAPLPQDLLDRRVEITGPVDRKMIVNALNSGAKVFMADFEDA
SGPQWTNMIEGQINLKDRWAGRIDFHDPSNGKDYKLGATPAVLIIRPRGWHLPEAHVTVD
GEEVSGALFDLGLYAFHNAKAALAQGSGPYFYLPKTESHLEARLWNDVFTLAETRLGLPA
NCIKGTVLIETLPAVFEMDEILYELRNHVAGLNIGRWDYIFSFIKRLGKNARFLTPDRAR
MVMSEAFLKAYGALLVKTCHRRKAFAMGGMAAQIPVKNNPEANEAAFAKVRADKEREAGD
GCDGTWVAHPDLVPVAMEVFNRLMPNPNQLDKLRSDVSVSRDDLLVVHQGPRTEGGLREN
IRVGVQYIEAWLRGRGAVPLYNLMEDAATAEISRAQIWQWIHLSAKLEDGRTVTGELFTS
LLNDEMAKLRETLTPAVYDKGRFPEAIKLFSDMTLADTFEEFLTLPAYRLVA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacccccgcccttccctcaggcgtcgccatcaccggggccatggcgccccgcttc
gaggaaatcctcacctccgaagcgctggccttcgtcgccgaactccaccgcaccttcaac
gccacccgcctcgcgctgctcgccaagcgcgccgagcggcaggcccgcttcgatgccggc
gaactgcccgacttcctgcccgagaccaagtccgtccgggacgccgagtggaccatcgcc
ccgctgccgcaggatctgctggaccgccgcgtggagatcaccggccctgtcgaccgcaag
atgatcgtgaacgcgctgaattccggcgccaaggtcttcatggcggacttcgaggatgcc
tcgggcccgcagtggaccaacatgatcgagggccagatcaacctgaaggaccgctgggcc
ggcaggatcgacttccatgatccgtccaacggcaaggactacaagctcggcgccacgccc
gccgtgctcatcatccgcccgcgcggctggcacctgccggaagcacatgtgacggtggac
ggcgaggaagtctccggcgccctgttcgacctcggcctctatgccttccacaacgccaag
gcggcgctggcgcagggctccggcccctatttctacctgcccaagaccgagagccatctc
gaagcccggctgtggaacgacgtcttcaccctcgccgagacccgcctcggcctgccggcc
aactgcatcaagggcacggtgctcatcgagaccctgccggccgtgttcgagatggacgag
atcctctacgagctgcgcaaccatgtggcgggcctcaacatcggccgctgggactacatc
ttctccttcatcaagcgcctcggaaagaacgcccgcttcctcaccccggaccgcgcccgc
atggtgatgagcgaggccttcctgaaggcctatggcgcgctgctggtgaagacctgccac
cgccgcaaggccttcgccatgggcggcatggcggcgcagatcccggtgaagaacaatccg
gaagccaacgaggccgccttcgccaaggtgcgcgcggacaaggagcgcgaggccggtgac
ggctgcgacggcacctgggtcgcccatccggacctcgtgccggtggccatggaagtgttc
aaccgtctgatgccgaacccgaaccagctcgacaagctgcggtccgacgtgagcgtgtcc
cgcgacgacctgctcgtcgtccatcagggcccgcgcacggaaggcggcctcagggagaac
atccgcgtcggcgtgcagtatatcgaagcgtggctgcgcggccgcggcgcggtgccgctc
tacaacctcatggaggatgcggccaccgccgagatcagccgcgcgcagatctggcagtgg
atccacctctccgccaagctggaggacggccgcacggtgacgggcgagctgttcaccagc
ctgctcaatgacgagatggccaagctgcgcgagacgctgacccccgccgtctatgacaag
ggccgcttcccggaagccattaagctgttctcggacatgacgctggccgacacgttcgag
gaattcctcaccctgccggcctaccggctggtggcctga

DBGET integrated database retrieval system