KEGG   Azorhizobium caulinodans: AZC_0136Help
Entry
AZC_0136          CDS       T00609                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAF86134
RhizoBase: AZC_0136
UniProt: A8IGU6
Position
complement(165098..165661)
Genome map
AA seq 187 aa AA seqDB search
MDSFELNKIAGAVLGTLTLTLGLGIVSEILFTPEAPAKPGYEIAVPEGGATGQAAPKAAA
EVPIAQLLPTASVEKGANVAKRCASCHNFAEGAGAKVGPDLYGVVGRKKASVAGFAYSSA
LQGKGGDWSFDDLNAFLTNPKAYVPGTAMAFAGIPKESERADLIAYLNTLSHSPLPLPKA
ADAAPAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatagttttgaattaaacaagatcgcaggcgcggtgctcggcacgctgacgttgacg
ctcggcctcggcatcgtgtccgaaatccttttcacgcccgaggctccggccaagcccggc
tacgagatcgcggtgccggaaggcggcgcgaccggccaggcggcccccaaggcggcggcc
gaggtgccgatcgcccagttgctgcccaccgcctccgtggagaagggagccaacgtcgcc
aagcgttgcgcctcctgccacaatttcgcggaaggtgccggtgccaaggtcggccctgat
ctctatggggtggtcggccgcaagaaggcgagcgtcgcgggctttgcctattcctcggcc
ctccagggcaagggtggcgactggtccttcgacgatctcaacgccttcctgaccaacccg
aaggcctatgtgcccggaaccgccatggcgttcgccggcattccgaaggagagcgagcgg
gcggacctcatcgcctatctcaacaccctctcccacagcccgctgccgctgcccaaggcc
gccgacgccgcaccggcgaagtga

DBGET integrated database retrieval system