KEGG   Azorhizobium caulinodans: AZC_0136Help
Entry
AZC_0136          CDS       T00609                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:azc00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:azc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(165098..165661)
Genome map
AA seq 187 aa AA seqDB search
MDSFELNKIAGAVLGTLTLTLGLGIVSEILFTPEAPAKPGYEIAVPEGGATGQAAPKAAA
EVPIAQLLPTASVEKGANVAKRCASCHNFAEGAGAKVGPDLYGVVGRKKASVAGFAYSSA
LQGKGGDWSFDDLNAFLTNPKAYVPGTAMAFAGIPKESERADLIAYLNTLSHSPLPLPKA
ADAAPAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatagttttgaattaaacaagatcgcaggcgcggtgctcggcacgctgacgttgacg
ctcggcctcggcatcgtgtccgaaatccttttcacgcccgaggctccggccaagcccggc
tacgagatcgcggtgccggaaggcggcgcgaccggccaggcggcccccaaggcggcggcc
gaggtgccgatcgcccagttgctgcccaccgcctccgtggagaagggagccaacgtcgcc
aagcgttgcgcctcctgccacaatttcgcggaaggtgccggtgccaaggtcggccctgat
ctctatggggtggtcggccgcaagaaggcgagcgtcgcgggctttgcctattcctcggcc
ctccagggcaagggtggcgactggtccttcgacgatctcaacgccttcctgaccaacccg
aaggcctatgtgcccggaaccgccatggcgttcgccggcattccgaaggagagcgagcgg
gcggacctcatcgcctatctcaacaccctctcccacagcccgctgccgctgcccaaggcc
gccgacgccgcaccggcgaagtga

DBGET integrated database retrieval system