KEGG   Azorhizobium caulinodans: AZC_0147Help
Entry
AZC_0147          CDS       T00609                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
azc  Azorhizobium caulinodans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:azc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZC_0147 (recR)
DNA repair and recombination proteins [BR:azc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AZC_0147 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
176330..176935
Genome map
AA seq 201 aa AA seqDB search
MSRAVAGPEIERLIQLLGRLPGLGPRSARRATLHLIKKRETLMAPLGLALQDVLGKIVEC
QVCGNVDVRDPCTVCTDIHRDSSVLVVVAEVADLWALERANAINAKYHVLGGVLSPLDGV
GPDDLNLTKLVERVGAGGVNEVILALGATVDAQTTAHYVTDLLRETGVKVTRLAHGVPVG
GELDHLDEGTLSAAIRARTAL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgccgtggccggtcccgagatcgaacgcctcatccagcttctgggccgcctg
ccgggccttggcccgcgctcggcccgccgggcgacgctgcatctcatcaagaagcgcgaa
acgctgatggcccccctcggcctcgccttgcaggatgtgctcggcaagatcgtcgagtgt
caggtgtgcgggaacgtggacgtgcgcgatccctgcacggtgtgcacggacatccatcgc
gattcgagcgtgctcgtggtggtggcggaggtggccgacctctgggcgttggagcgggcc
aacgccatcaacgccaagtatcatgtgctcggcggcgtgctctctccgctcgacggcgtg
ggcccggacgacctcaatctgacaaagctcgttgagcgcgtgggggcgggtggcgtcaac
gaggtgatcctcgcgctcggcgccaccgtcgatgcccagaccaccgcccattatgtcacc
gacctgctgcgcgagaccggcgtgaaggtgacccgcctcgcccatggcgtgccggtgggc
ggcgagctggaccatctggacgaaggcacgctctccgctgccatccgcgcccgcacggcg
ctctga

DBGET integrated database retrieval system