KEGG   Azorhizobium caulinodans: AZC_0162Help
Entry
AZC_0162          CDS       T00609                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
azc  Azorhizobium caulinodans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZC_0162
   00052 Galactose metabolism
    AZC_0162
   00500 Starch and sucrose metabolism
    AZC_0162
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_0162
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZC_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(191159..192157)
Genome map
AA seq 332 aa AA seqDB search
MLKFCNQFRAIALLCEHPVSCVRKPGFSILGNKERGVMPKPLRKAILPVAGLGTRFLPAT
KAVPKEMLTVVDRPVVQHVVDEAVAAGIEHIVFVTGRNKAVIEDHFDRQFELEKTLADRG
KTKELAQLDRDTPKAGTTSFTRQQLPLGLGHAVWCARDLIGDEPFALLLPDMLHLPNGNG
KGCLTEMVETYNKTGGNVISVYEVPDDQTNQYGIVGLGKETSAKAHEITQMVEKPAAGTA
PSNLAISGRYILQPTIFDLLAKQEQGAGNEIQLTDSMLKLMERERFFSVRFDGSVYDCGS
KIGFLMANVAYALSRPDIAPEFRTELGHFLGN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagttttgcaaccaattccgggccatagcgttgctttgcgaacacccagtttcc
tgtgttaggaagccgggcttttccattttgggaaataaggaacggggcgtcatgccaaag
ccacttcgcaaagccatcctgccggtcgcgggtctgggaacgcgcttccttccggccacc
aaggcggtgccgaaggagatgctgacggtggtggaccgtcccgtggtgcagcacgtcgtg
gacgaggcggtcgccgccggcatcgagcacatcgtcttcgtcaccggccgcaacaaggcg
gtgatcgaggaccatttcgatcgccagttcgagctcgagaagacccttgccgaccgcggc
aagaccaaggaactcgcgcagctcgaccgcgacacaccgaaggccggcaccacctccttc
acccgccagcagctgcctctcggccttggccatgcggtctggtgcgcccgggacctgatc
ggcgacgaacccttcgcgcttctcctgcccgacatgctccatctgcccaacggcaacggc
aagggctgcctcaccgagatggtggagacctacaacaagaccggcggcaacgtgatctcg
gtctatgaggttcccgacgaccagacgaaccagtacggcatcgtcggcctcggcaaggaa
accagcgccaaggcgcacgagatcacccagatggtcgagaagccggcggccggcacggcg
ccgagcaacctcgccatctccggccgctacatcctccagcccaccatcttcgacctgctc
gccaagcaggagcagggcgcgggcaacgagatccagctcaccgactcgatgctgaagctg
atggagcgcgagcgcttcttctccgtccgcttcgacggctcggtctatgactgcggctcg
aagatcggcttcctcatggcgaacgtcgcctatgccctgtcgcggcccgacatcgcgccg
gaattccggacggaactcggtcacttcctcggcaattga

DBGET integrated database retrieval system