KEGG   Azorhizobium caulinodans: AZC_0162Help
Entry
AZC_0162          CDS       T00609                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
azc  Azorhizobium caulinodans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZC_0162
   00052 Galactose metabolism
    AZC_0162
   00500 Starch and sucrose metabolism
    AZC_0162
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_0162
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AZC_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(191159..192157)
Genome map
AA seq 332 aa AA seqDB search
MLKFCNQFRAIALLCEHPVSCVRKPGFSILGNKERGVMPKPLRKAILPVAGLGTRFLPAT
KAVPKEMLTVVDRPVVQHVVDEAVAAGIEHIVFVTGRNKAVIEDHFDRQFELEKTLADRG
KTKELAQLDRDTPKAGTTSFTRQQLPLGLGHAVWCARDLIGDEPFALLLPDMLHLPNGNG
KGCLTEMVETYNKTGGNVISVYEVPDDQTNQYGIVGLGKETSAKAHEITQMVEKPAAGTA
PSNLAISGRYILQPTIFDLLAKQEQGAGNEIQLTDSMLKLMERERFFSVRFDGSVYDCGS
KIGFLMANVAYALSRPDIAPEFRTELGHFLGN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagttttgcaaccaattccgggccatagcgttgctttgcgaacacccagtttcc
tgtgttaggaagccgggcttttccattttgggaaataaggaacggggcgtcatgccaaag
ccacttcgcaaagccatcctgccggtcgcgggtctgggaacgcgcttccttccggccacc
aaggcggtgccgaaggagatgctgacggtggtggaccgtcccgtggtgcagcacgtcgtg
gacgaggcggtcgccgccggcatcgagcacatcgtcttcgtcaccggccgcaacaaggcg
gtgatcgaggaccatttcgatcgccagttcgagctcgagaagacccttgccgaccgcggc
aagaccaaggaactcgcgcagctcgaccgcgacacaccgaaggccggcaccacctccttc
acccgccagcagctgcctctcggccttggccatgcggtctggtgcgcccgggacctgatc
ggcgacgaacccttcgcgcttctcctgcccgacatgctccatctgcccaacggcaacggc
aagggctgcctcaccgagatggtggagacctacaacaagaccggcggcaacgtgatctcg
gtctatgaggttcccgacgaccagacgaaccagtacggcatcgtcggcctcggcaaggaa
accagcgccaaggcgcacgagatcacccagatggtcgagaagccggcggccggcacggcg
ccgagcaacctcgccatctccggccgctacatcctccagcccaccatcttcgacctgctc
gccaagcaggagcagggcgcgggcaacgagatccagctcaccgactcgatgctgaagctg
atggagcgcgagcgcttcttctccgtccgcttcgacggctcggtctatgactgcggctcg
aagatcggcttcctcatggcgaacgtcgcctatgccctgtcgcggcccgacatcgcgccg
gaattccggacggaactcggtcacttcctcggcaattga

DBGET integrated database retrieval system