KEGG   Azorhizobium caulinodans: AZC_0285Help
Entry
AZC_0285          CDS       T00609                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0285
   00030 Pentose phosphate pathway
    AZC_0285
   00051 Fructose and mannose metabolism
    AZC_0285
   00052 Galactose metabolism
    AZC_0285
   00500 Starch and sucrose metabolism
    AZC_0285
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_0285
  Nucleotide metabolism
   00230 Purine metabolism
    AZC_0285
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZC_0285
Enzymes [BR:azc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     AZC_0285
    5.4.2.8  phosphomannomutase
     AZC_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(330853..332352)
Genome map
AA seq 499 aa AA seqDB search
MFPTPKPALTPNTYAYESEPMVKPTGFREYDARWLFQKEINLMGVQALGMGLGTLMHEMG
IKPEIVTGHDFRGYSSSIKYAMVSGLMAAGVKVHDIGLAMSPMAYFAQFALDVPAVAMVT
ASHNDNGWTGVKMGVNRPLTFGPDEMTRLKEIVLCAKFDLKGGGAYQFVENFPEIYIKDL
TDRPKLKHPIKAVVACGNGTAGAFAPRILEALGVEVVPLDTELDHSFPKYNPNPEDLEML
HAMRDAVLASGADVALGFDGDGDRCGVVDNEGEEIFADKMGVMLARDLAKLYPNSTFVVD
VKSTGLFATDPELIKLGVKADYWKTGHSYMKRRVNESGALVGFEKSGHYFFNKPIGRGYD
DGLVSAIAVLDMLDRNPGKKLSELRLALPKTWSSPTMSPHCADEAKYGIVEQVVKHYQKL
QAEGAKVTGQAIRDLVTVNGVRVTTEDGSWGLVRASSNKPELVVVVESPVSEARMREMFA
EVDSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgacgccgaagcccgcactgacgccgaacacctacgcctatgaatccgagccc
atggtgaagcccaccgggttccgcgagtatgacgcccgctggttgttccagaaggaaatc
aacctcatgggcgtgcaggcgctgggcatgggcctcggcacgctgatgcacgaaatgggc
atcaagccggagatcgtcaccggccacgacttccgcggttattcctcctccatcaagtac
gccatggtctccggcctcatggccgccggcgtgaaggtgcacgacatcggccttgccatg
tcgcccatggcctatttcgcccagttcgccctcgacgtgccggcggtggcgatggtcacg
gcctcgcacaatgacaatggctggaccggcgtgaagatgggcgtgaaccgccccctcacc
ttcggcccggatgagatgacccgcctgaaggagatcgtgctctgtgcgaagttcgacctg
aagggcggcggcgcctatcagttcgtcgagaacttccccgagatctacatcaaggatctc
accgaccggccgaagctgaagcaccccatcaaggcggtggtggcctgcggcaatggcacg
gccggcgccttcgccccgcgcatccttgaggcgctcggcgtggaagtggtgccgctcgat
accgagctcgaccactccttcccgaagtacaatccgaaccccgaagacctcgagatgctc
cacgccatgcgcgatgccgtgctggcctcgggcgccgacgtggcgctgggcttcgacggc
gacggcgaccgctgcggcgtggtggacaatgagggcgaggaaatcttcgccgacaagatg
ggcgtgatgctcgcccgcgacctcgccaagctctatcccaactccaccttcgtggtggat
gtgaagtccacgggcctgttcgccactgatcccgagctgatcaagctcggcgtgaaggcg
gattactggaagaccggccattcctacatgaagcgccgggtgaacgagagcggcgccctc
gtcggcttcgagaagtcgggccactatttcttcaacaagcccatcggccgcggctatgac
gacggcctcgtctcggccatcgccgtactggacatgctcgatcgcaatccgggcaagaag
ctctccgaactgcgcctcgcgctgcccaagacctggtcgtcgcccaccatgtcaccccac
tgcgcggacgaggccaagtacggcatcgtggagcaggtggtgaagcactatcagaagctt
caggccgagggcgcgaaggtgacgggtcaggcgatccgcgacctcgtgacggtgaacggc
gtgcgcgtcaccaccgaagacggttcctggggcctggtgcgcgcctcctccaacaagccc
gaactggtggtggtggtggaaagccccgtctccgaggcccgcatgcgcgagatgttcgcc
gaggtggacagcgtgctgcgcacccatccggaagtcggcgagtacaaccagaagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system