KEGG   Azorhizobium caulinodans: AZC_0301Help
Entry
AZC_0301          CDS       T00609                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_0301
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0301
   00620 Pyruvate metabolism
    AZC_0301
   00640 Propanoate metabolism
    AZC_0301
  Energy metabolism
   00680 Methane metabolism
    AZC_0301
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZC_0301
Lipid biosynthesis proteins [BR:azc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZC_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
349704..351710
Genome map
AA seq 668 aa AA seqDB search
MRKQAGFSVREPGGKTVSEQNYFHVPAEWASRAFVDKAGYEAMYKASVENPEAFWAEQGK
RIDWFEPYTKVKNTSFIPGAVSIKWFEDGVTNIAHNCVDRHLEKRGDQVAIIWEGDSPTE
SRKITYRELASEVNKFANVLRNRDVQKGDRVTIYLPMIPEAAFAMLACARLGAVHSIVFA
GFSPDSLAGRISDCGSKVVITADEGLRGGRKVPLKANVDAAIERLPEPVDHVIVVRRTGA
TVAMEPGRDVWYHEAAEMVTDECPAEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYA
AMTHQYVFDYHEGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSNARFWEV
IDKHQVNIFYTAPTAIRALMQAGEDPVKKTSRASLRLLGSVGEPINPEAWHWYHRVVGEG
RCPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGIVPQLVDAEGRVLDGAAEGNLV
IADSWPGQMRTVYGDHERFEQTYFSTYPGKYFTGDGCRRDEDGYYWITGRVDDVINVSGH
RMGTAEVESALVAHPKVSEAAVVGFPHDIKGQGIYAYVTLMAGENPSEELRKELVAWVRK
EIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDQFENLGDTSTLADPGVVEDLVSNR
QNKREAAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacaagcgggcttcagcgtccgcgaaccgggaggcaagacggtgtccgagcag
aattatttccacgtgccggccgaatgggcctcgcgggcctttgtggacaaggcgggttac
gaggccatgtacaaggcctccgtcgaaaatccggaggccttctgggccgagcagggcaag
cgcatcgactggttcgagccctacacgaaggtgaagaacacctcgttcatccccggcgcc
gtctctatcaaatggttcgaggatggcgtcaccaacatcgcccataattgcgtggaccgg
catctggagaagcgcggcgatcaggtggcgatcatctgggagggcgatagcccgaccgag
agccgcaagatcacctatcgcgagcttgcctccgaggtgaacaagttcgccaacgtgctg
cgcaaccgcgatgtgcagaagggcgaccgcgtcaccatctatctgcccatgatccccgag
gcggcgttcgcgatgctcgcctgcgcgcgccttggagccgtgcattccatcgtcttcgcc
ggcttctcgccggacagcctcgcgggccgcatttccgactgcggctccaaggtggtgatc
accgccgacgagggcctgcgtggcggccgcaaggtgccgctgaaggccaatgtggacgcc
gccatcgagcgcctgcccgagccggtggaccatgtgatcgtcgtgcgccgcacgggcgcg
accgtcgccatggagccgggccgcgacgtctggtaccacgaggccgccgagatggtgacc
gacgagtgcccggccgagccgatgaatgcggaagatccgctgttcatcctctacacctcc
ggctccaccggaaagccaaagggcgtcctgcacaccaccggcggctatctcgtctatgcc
gccatgacgcaccagtatgtcttcgattatcacgagggcgacatctactggtgcacggcc
gacgtgggatgggtgaccggccactcctacatcgtctacggcccgctcgcgaacggcgcc
acgacgctgatgttcgagggcgtgcccaattatccgtcgaacgcccgcttctgggaggtg
atcgacaagcatcaggtcaacatcttctacaccgcccccaccgccatccgcgcgctgatg
caggcgggcgaggatccggtgaagaagaccagccgcgcctcgctgcgcctgctcggctcg
gtgggcgagcccatcaatccggaagcctggcactggtatcaccgcgtggtgggcgagggc
cgctgccccatcgtggacacctggtggcagacggagaccggaggcatcctcatcaccccg
ctgccgggtgcgaccgctctgaagccgggctccgccacgcgccccttcttcggcatcgtg
ccgcagctggtggatgcggagggccgcgtgctggacggcgcggcggaaggcaatcttgtg
atcgctgacagctggccgggccagatgcgcacggtctatggcgaccatgagcgcttcgag
cagacctatttctccacctatcccggcaagtatttcaccggcgacggctgccgccgcgac
gaggacggctattactggatcaccggccgcgtggacgatgtgatcaacgtctcgggccac
cgcatgggcacggccgaggtggagagtgcgcttgtcgcccaccccaaggtctcggaagca
gcggtggtggggttcccgcacgacatcaagggccagggcatctatgcctatgtcaccctc
atggcgggcgagaacccgtccgaggaactccgcaaggagctggtggcctgggtgcgcaag
gagatcggaccgatcgcctcgccggacctcatccagttcgcgcccggcctgcccaagacg
cgctcgggcaagatcatgcgccggatcctgcgcaagatcgccgaggatcagttcgagaat
ctgggcgacacctccacgctcgccgatcctggcgtggtggaggatctggtcagcaatcgc
cagaacaagcgcgaggcggcggcctga

DBGET integrated database retrieval system