KEGG   Azorhizobium caulinodans: AZC_0301Help
Entry
AZC_0301          CDS       T00609                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00010  Glycolysis / Gluconeogenesis
azc00620  Pyruvate metabolism
azc00640  Propanoate metabolism
azc00680  Methane metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0301
   00620 Pyruvate metabolism
    AZC_0301
   00640 Propanoate metabolism
    AZC_0301
  Energy metabolism
   00680 Methane metabolism
    AZC_0301
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZC_0301
Lipid biosynthesis proteins [BR:azc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZC_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAF86299
RhizoBase: AZC_0301
UniProt: A8IJG4
Position
349704..351710
Genome map
AA seq 668 aa AA seqDB search
MRKQAGFSVREPGGKTVSEQNYFHVPAEWASRAFVDKAGYEAMYKASVENPEAFWAEQGK
RIDWFEPYTKVKNTSFIPGAVSIKWFEDGVTNIAHNCVDRHLEKRGDQVAIIWEGDSPTE
SRKITYRELASEVNKFANVLRNRDVQKGDRVTIYLPMIPEAAFAMLACARLGAVHSIVFA
GFSPDSLAGRISDCGSKVVITADEGLRGGRKVPLKANVDAAIERLPEPVDHVIVVRRTGA
TVAMEPGRDVWYHEAAEMVTDECPAEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYA
AMTHQYVFDYHEGDIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSNARFWEV
IDKHQVNIFYTAPTAIRALMQAGEDPVKKTSRASLRLLGSVGEPINPEAWHWYHRVVGEG
RCPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGIVPQLVDAEGRVLDGAAEGNLV
IADSWPGQMRTVYGDHERFEQTYFSTYPGKYFTGDGCRRDEDGYYWITGRVDDVINVSGH
RMGTAEVESALVAHPKVSEAAVVGFPHDIKGQGIYAYVTLMAGENPSEELRKELVAWVRK
EIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDQFENLGDTSTLADPGVVEDLVSNR
QNKREAAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacaagcgggcttcagcgtccgcgaaccgggaggcaagacggtgtccgagcag
aattatttccacgtgccggccgaatgggcctcgcgggcctttgtggacaaggcgggttac
gaggccatgtacaaggcctccgtcgaaaatccggaggccttctgggccgagcagggcaag
cgcatcgactggttcgagccctacacgaaggtgaagaacacctcgttcatccccggcgcc
gtctctatcaaatggttcgaggatggcgtcaccaacatcgcccataattgcgtggaccgg
catctggagaagcgcggcgatcaggtggcgatcatctgggagggcgatagcccgaccgag
agccgcaagatcacctatcgcgagcttgcctccgaggtgaacaagttcgccaacgtgctg
cgcaaccgcgatgtgcagaagggcgaccgcgtcaccatctatctgcccatgatccccgag
gcggcgttcgcgatgctcgcctgcgcgcgccttggagccgtgcattccatcgtcttcgcc
ggcttctcgccggacagcctcgcgggccgcatttccgactgcggctccaaggtggtgatc
accgccgacgagggcctgcgtggcggccgcaaggtgccgctgaaggccaatgtggacgcc
gccatcgagcgcctgcccgagccggtggaccatgtgatcgtcgtgcgccgcacgggcgcg
accgtcgccatggagccgggccgcgacgtctggtaccacgaggccgccgagatggtgacc
gacgagtgcccggccgagccgatgaatgcggaagatccgctgttcatcctctacacctcc
ggctccaccggaaagccaaagggcgtcctgcacaccaccggcggctatctcgtctatgcc
gccatgacgcaccagtatgtcttcgattatcacgagggcgacatctactggtgcacggcc
gacgtgggatgggtgaccggccactcctacatcgtctacggcccgctcgcgaacggcgcc
acgacgctgatgttcgagggcgtgcccaattatccgtcgaacgcccgcttctgggaggtg
atcgacaagcatcaggtcaacatcttctacaccgcccccaccgccatccgcgcgctgatg
caggcgggcgaggatccggtgaagaagaccagccgcgcctcgctgcgcctgctcggctcg
gtgggcgagcccatcaatccggaagcctggcactggtatcaccgcgtggtgggcgagggc
cgctgccccatcgtggacacctggtggcagacggagaccggaggcatcctcatcaccccg
ctgccgggtgcgaccgctctgaagccgggctccgccacgcgccccttcttcggcatcgtg
ccgcagctggtggatgcggagggccgcgtgctggacggcgcggcggaaggcaatcttgtg
atcgctgacagctggccgggccagatgcgcacggtctatggcgaccatgagcgcttcgag
cagacctatttctccacctatcccggcaagtatttcaccggcgacggctgccgccgcgac
gaggacggctattactggatcaccggccgcgtggacgatgtgatcaacgtctcgggccac
cgcatgggcacggccgaggtggagagtgcgcttgtcgcccaccccaaggtctcggaagca
gcggtggtggggttcccgcacgacatcaagggccagggcatctatgcctatgtcaccctc
atggcgggcgagaacccgtccgaggaactccgcaaggagctggtggcctgggtgcgcaag
gagatcggaccgatcgcctcgccggacctcatccagttcgcgcccggcctgcccaagacg
cgctcgggcaagatcatgcgccggatcctgcgcaagatcgccgaggatcagttcgagaat
ctgggcgacacctccacgctcgccgatcctggcgtggtggaggatctggtcagcaatcgc
cagaacaagcgcgaggcggcggcctga

DBGET integrated database retrieval system