KEGG   Azorhizobium caulinodans: AZC_0320Help
Entry
AZC_0320          CDS       T00609                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AZC_0320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0320
  Lipid metabolism
   00071 Fatty acid degradation
    AZC_0320
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZC_0320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZC_0320
   00626 Naphthalene degradation
    AZC_0320
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZC_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(367658..368683)
Genome map
AA seq 341 aa AA seqDB search
MTNMMKAAVVHQLGQPLVIEQVPVPEPGPEQILVRIAATGVCHTDLHAVKGDWPVKPKPP
FIPGHEGVGTVVGVGSRVKRVKEGDRVGIPWLHTACGYCPHCRTGWETLCADQQNTGYSV
NGSFAEYAVADPNYVGRLPDKLDWGPAAPVLCAGVTVYKGLKETEVKPGEWVAISGIGGL
GHMAVQYAKAMGMHVVAIDVHPDKLELAKKLGAELVVNAREEDPGAVVQKAIGGVHGVLV
TAVSPKAFEQAFNVLRAHGTMALCGLPPGMFAMPIFDTVLKRITVRGSIVGTRQDLEEAL
EFAGNGQVAAHFSWDKLENINEIFHRMEEGGIDGRIVLNMN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacatgatgaaagccgccgtcgtccaccagctgggccagcccctcgtgatcgag
caggtgcccgtgccagagccaggccccgagcagattctcgtgcgcatcgccgccaccggc
gtgtgccacaccgatctgcatgcggtgaagggcgactggccggtgaagccgaagccgccg
ttcattcccggccatgagggcgtcggcaccgtggtcggcgtcggcagccgggtgaagcgc
gtgaaggaaggcgaccgcgtgggcattccgtggctgcacaccgcctgcggctattgtccc
cactgccgcacggggtgggaaacgctttgcgccgaccagcagaacaccggctattccgtc
aacggcagctttgccgaatatgcggtggctgaccccaattacgtgggccgcctgcccgac
aagctggactggggtccggccgcgcccgtgctgtgcgccggcgtgacggtttacaagggc
ctgaaggaaaccgaggtgaagccgggcgaatgggtcgccatttcgggcatcggcgggctc
ggccacatggccgtgcagtatgccaaggccatgggcatgcatgtggtggccatcgacgtg
caccccgacaagctggaactggcgaagaagctgggtgccgaactggtcgtgaacgcccgt
gaggaagatccgggtgccgtggtgcagaaggccatcggcggcgtccacggtgtgctcgtc
acggccgtctcgcccaaggcgttcgaacaggcgttcaacgtgctgcgcgcccacggcacc
atggccctgtgcggcctgcctccgggcatgttcgccatgcccatcttcgacacggtgctg
aagcgcatcaccgtgcgcggctccatcgtgggcacccgccaggatctggaggaggccctc
gagttcgccggcaacggtcaggtggccgcccacttctcgtgggacaagctcgagaacatc
aacgagatcttccaccgcatggaagaaggcggcatcgacgggcgcatcgtcctcaacatg
aactga

DBGET integrated database retrieval system