KEGG   Azorhizobium caulinodans: AZC_0664Help
Entry
AZC_0664          CDS       T00609                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azc  Azorhizobium caulinodans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_0664
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AZC_0664
Enzymes [BR:azc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AZC_0664
Two-component system [BR:azc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AZC_0664
Bacterial motility proteins [BR:azc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AZC_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
734370..735608
Genome map
AA seq 412 aa AA seqDB search
MSTSAPSADTGAVEDPIRVMIVDDSVFIRGILSNWLGESPDLRVVATHANGRRAVDDVQK
SLPDVVILDLEMPEMDGLTALPLILEKKPNTVVLVASTLTRRGAEVSLKAMSLGAADYVP
KPDAGRGISAADEFRRDLTAKVRSLGQRVRRRGSLPRVMAAAAASAAAAPAAAPATAGAA
APAPARPAAPAAGAAPAAPVSAFAKPKVNDKRRPYSMSPVTVLAVGSSTGGPQALTRLFT
DIGPSIANVPVVIVQHMPATFTAILAEHVGRAAGRPAAEGIDGEVVKPGHIYIAPGGKHM
VLEKSGNDKVIRLHDGPPVNFCKPAVDPMFDTVSEIYGRNALAVVLTGMGSDGAKGAGRI
ADAGGSVIAQDEETSVVWGMPGATVQMGNASEVLSIADIGRKVSRLLTGGRA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttccgcgccttcagcggatacgggagccgtcgaagatccgatccgcgtgatg
atcgtggatgacagtgtcttcattcgcggaatcctatccaactggctcggggaatcgcca
gacctgcgggtcgtcgccacgcacgccaacggccgccgcgccgtggacgacgtgcagaag
tcgctgcctgacgtggtcatcctcgacctcgaaatgccggagatggacgggcttacggcc
ctgcccctcatccttgagaaaaagccgaacaccgtcgtcctggtggcctccacgctgacc
cggcgcggggcggaagtctcgctgaaggcgatgagcctcggtgcggccgactatgtgccg
aagccggacgccggccgcggcatctcggccgccgacgagttccgccgcgacctgaccgcg
aaggtgcgcagccttggacagcgcgtgcgtcgccgcggcagcctgccgcgcgtgatggcc
gctgctgccgcgtccgcggctgcggcgcctgccgcagctccggccactgcgggtgcggct
gcgccggcaccggcccggcccgcggcacctgcggcgggagcggctcccgcggctccggtc
tcggccttcgccaagccgaaggtgaacgacaagcgccggccttattccatgtcgccggtg
accgtgctggcggtgggcagctccacgggcgggccgcaggccctcacgcgcctgttcacc
gacatcgggccgtccatcgccaacgtgcccgtggtgatcgtgcagcacatgccggccacc
ttcaccgccattctcgccgagcacgtgggacgtgcggcggggcgtccggcggcggaaggc
attgatggcgaggtggtgaagcctggccacatctatatcgcgccgggcggcaagcacatg
gtgctggagaagtccggcaacgacaaggtgatccgcctgcatgacgggccgccggtgaat
ttctgcaagccggccgtcgatccgatgttcgacaccgtttcggaaatctacggccgcaac
gcgctggcggtcgtgctgaccggaatgggcagtgacggggccaagggcgccggccgtatc
gccgatgccggtggcagcgtgattgcgcaagacgaagaaacaagcgtcgtttggggcatg
cccggtgcgaccgtccagatggggaacgcctccgaagttctctccatcgcagacatcggc
cgcaaggtgtctcgcttgctgacgggaggacgggcatga

DBGET integrated database retrieval system