KEGG   Azorhizobium caulinodans: AZC_0664Help
Entry
AZC_0664          CDS       T00609                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
azc  Azorhizobium caulinodans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:azc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:azc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
734370..735608
Genome map
AA seq 412 aa AA seqDB search
MSTSAPSADTGAVEDPIRVMIVDDSVFIRGILSNWLGESPDLRVVATHANGRRAVDDVQK
SLPDVVILDLEMPEMDGLTALPLILEKKPNTVVLVASTLTRRGAEVSLKAMSLGAADYVP
KPDAGRGISAADEFRRDLTAKVRSLGQRVRRRGSLPRVMAAAAASAAAAPAAAPATAGAA
APAPARPAAPAAGAAPAAPVSAFAKPKVNDKRRPYSMSPVTVLAVGSSTGGPQALTRLFT
DIGPSIANVPVVIVQHMPATFTAILAEHVGRAAGRPAAEGIDGEVVKPGHIYIAPGGKHM
VLEKSGNDKVIRLHDGPPVNFCKPAVDPMFDTVSEIYGRNALAVVLTGMGSDGAKGAGRI
ADAGGSVIAQDEETSVVWGMPGATVQMGNASEVLSIADIGRKVSRLLTGGRA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttccgcgccttcagcggatacgggagccgtcgaagatccgatccgcgtgatg
atcgtggatgacagtgtcttcattcgcggaatcctatccaactggctcggggaatcgcca
gacctgcgggtcgtcgccacgcacgccaacggccgccgcgccgtggacgacgtgcagaag
tcgctgcctgacgtggtcatcctcgacctcgaaatgccggagatggacgggcttacggcc
ctgcccctcatccttgagaaaaagccgaacaccgtcgtcctggtggcctccacgctgacc
cggcgcggggcggaagtctcgctgaaggcgatgagcctcggtgcggccgactatgtgccg
aagccggacgccggccgcggcatctcggccgccgacgagttccgccgcgacctgaccgcg
aaggtgcgcagccttggacagcgcgtgcgtcgccgcggcagcctgccgcgcgtgatggcc
gctgctgccgcgtccgcggctgcggcgcctgccgcagctccggccactgcgggtgcggct
gcgccggcaccggcccggcccgcggcacctgcggcgggagcggctcccgcggctccggtc
tcggccttcgccaagccgaaggtgaacgacaagcgccggccttattccatgtcgccggtg
accgtgctggcggtgggcagctccacgggcgggccgcaggccctcacgcgcctgttcacc
gacatcgggccgtccatcgccaacgtgcccgtggtgatcgtgcagcacatgccggccacc
ttcaccgccattctcgccgagcacgtgggacgtgcggcggggcgtccggcggcggaaggc
attgatggcgaggtggtgaagcctggccacatctatatcgcgccgggcggcaagcacatg
gtgctggagaagtccggcaacgacaaggtgatccgcctgcatgacgggccgccggtgaat
ttctgcaagccggccgtcgatccgatgttcgacaccgtttcggaaatctacggccgcaac
gcgctggcggtcgtgctgaccggaatgggcagtgacggggccaagggcgccggccgtatc
gccgatgccggtggcagcgtgattgcgcaagacgaagaaacaagcgtcgtttggggcatg
cccggtgcgaccgtccagatggggaacgcctccgaagttctctccatcgcagacatcggc
cgcaaggtgtctcgcttgctgacgggaggacgggcatga

DBGET integrated database retrieval system