KEGG   Azorhizobium caulinodans: AZC_0760Help
Entry
AZC_0760          CDS       T00609                                 

Definition
nitrate ABC transporter substrate-binding protein
Orthology
K15576  
nitrate/nitrite transport system substrate-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AZC_0760
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZC_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
859736..861097
Genome map
AA seq 453 aa AA seqDB search
MARFDPVRRFSRLLSGCSCGRHRSAAEHDGAAAARDAEARYAGAVEKTVLQALFPQAVQR
RAFLKAIGGSSVAAALAPFLNLGAVTDAFAQGAGAIEKKDLKIGFIPITCATPIIMAHPL
GFYTKQGLNVDVVKTAGWAVVRDKTINKEYDAAHMLSPMPIAISMGLGSNPIPFSVPAIE
NVNGQAITLAMKHKDKRNPKDWKGMKLAVPFDYSMHNYLLRYYLAENGIDPDTDVQIRSV
PPPEMVANLRADNIDGFLAPDNVAQRAVYDGVGFIHILSKEIWDGHPCCSFTASQEFVTA
NPNTYAALLRAIIDASAYAQKPENRKEIAEAIAPANYLNAPPIVLEQVLTGTYADGLGNI
KKDPDRITFDPFPYESFAVWILTQMKRWGQVKGEVDYQGIAKKVFLATEASKVMKEMGLT
PPASATKTFSVMGKPFDPAKPEDYVASFAIKRA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctttgatcctgtgcggcggttttcacgcttgttatccggctgctcctgcggc
cggcatcgctccgcggccgaacatgacggcgcggccgccgcgcgtgacgcggaagcgcgt
tatgcgggtgccgtcgagaagaccgtgcttcaggccctctttccgcaggccgtgcagcgc
cgcgccttcctcaaggccattggcggctcgtcggtggcggctgcgctcgcccccttcctc
aatctcggggcggtgacggacgcattcgcgcagggcgccggagccattgagaaaaaggat
ctcaagatcggcttcatcccgatcacctgcgccacgcccatcatcatggcccacccgctc
ggcttctataccaagcaggggctcaatgtggacgtggtgaagaccgccggctgggcggtg
gtgcgcgacaagaccatcaacaaggaatatgacgcggcgcacatgctctcgcccatgccc
atcgccatctcgatgggtcttggctccaatcccattcccttctccgtcccggccatcgaa
aatgtgaacgggcaggcgatcacgctcgccatgaagcacaaggacaagcgcaatccgaag
gactggaagggcatgaaactcgccgtgcccttcgattattccatgcacaattacctgctg
cgctattatctggcggaaaacggcatcgatcccgacacggatgtgcagatccgctccgtg
ccgccgccggagatggtcgccaacctgcgcgcggacaatatcgacggcttcctggcgccc
gataatgtggcccagagggcggtctatgacggtgtgggcttcatccacatcctctccaag
gagatctgggacgggcacccctgctgctccttcaccgccagccaggaattcgtgaccgcc
aatccgaacacctatgcggcgctgctgcgcgccatcatcgacgccagcgcctatgcgcag
aagccggagaaccgcaaggagatcgccgaggccatcgccccggccaattatctcaacgcg
ccgcccatcgttctggagcaggtgctcaccggcacctatgcggatggcctcggcaacatc
aagaaggatccggaccgcatcaccttcgatcccttcccctatgagagcttcgcggtgtgg
atcctcacccagatgaagcgctgggggcaggtgaagggcgaggtggattatcagggcatc
gcgaagaaggtcttcctcgccaccgaagcctccaaggtgatgaaagaaatgggcctgacg
ccaccggcttccgcgaccaagaccttctcggtgatgggcaagcccttcgatccggcgaag
cccgaagactatgtggcgagcttcgccatcaagcgggcctga

DBGET integrated database retrieval system