KEGG   Azorhizobium caulinodans: AZC_0760Help
Entry
AZC_0760          CDS       T00609                                 

Definition
(GenBank) ABC transporter nitrate-binding protein
  KO
K15576  nitrate/nitrite transport system substrate-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc00910  Nitrogen metabolism
azc02010  ABC transporters
Module
azc_M00438  Nitrate/nitrite transport system
azc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AZC_0760
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AZC_0760
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    AZC_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1_2 NMT1 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: BAF86758
RhizoBase: AZC_0760
UniProt: A8IQA0
Position
859736..861097
Genome map
AA seq 453 aa AA seqDB search
MARFDPVRRFSRLLSGCSCGRHRSAAEHDGAAAARDAEARYAGAVEKTVLQALFPQAVQR
RAFLKAIGGSSVAAALAPFLNLGAVTDAFAQGAGAIEKKDLKIGFIPITCATPIIMAHPL
GFYTKQGLNVDVVKTAGWAVVRDKTINKEYDAAHMLSPMPIAISMGLGSNPIPFSVPAIE
NVNGQAITLAMKHKDKRNPKDWKGMKLAVPFDYSMHNYLLRYYLAENGIDPDTDVQIRSV
PPPEMVANLRADNIDGFLAPDNVAQRAVYDGVGFIHILSKEIWDGHPCCSFTASQEFVTA
NPNTYAALLRAIIDASAYAQKPENRKEIAEAIAPANYLNAPPIVLEQVLTGTYADGLGNI
KKDPDRITFDPFPYESFAVWILTQMKRWGQVKGEVDYQGIAKKVFLATEASKVMKEMGLT
PPASATKTFSVMGKPFDPAKPEDYVASFAIKRA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctttgatcctgtgcggcggttttcacgcttgttatccggctgctcctgcggc
cggcatcgctccgcggccgaacatgacggcgcggccgccgcgcgtgacgcggaagcgcgt
tatgcgggtgccgtcgagaagaccgtgcttcaggccctctttccgcaggccgtgcagcgc
cgcgccttcctcaaggccattggcggctcgtcggtggcggctgcgctcgcccccttcctc
aatctcggggcggtgacggacgcattcgcgcagggcgccggagccattgagaaaaaggat
ctcaagatcggcttcatcccgatcacctgcgccacgcccatcatcatggcccacccgctc
ggcttctataccaagcaggggctcaatgtggacgtggtgaagaccgccggctgggcggtg
gtgcgcgacaagaccatcaacaaggaatatgacgcggcgcacatgctctcgcccatgccc
atcgccatctcgatgggtcttggctccaatcccattcccttctccgtcccggccatcgaa
aatgtgaacgggcaggcgatcacgctcgccatgaagcacaaggacaagcgcaatccgaag
gactggaagggcatgaaactcgccgtgcccttcgattattccatgcacaattacctgctg
cgctattatctggcggaaaacggcatcgatcccgacacggatgtgcagatccgctccgtg
ccgccgccggagatggtcgccaacctgcgcgcggacaatatcgacggcttcctggcgccc
gataatgtggcccagagggcggtctatgacggtgtgggcttcatccacatcctctccaag
gagatctgggacgggcacccctgctgctccttcaccgccagccaggaattcgtgaccgcc
aatccgaacacctatgcggcgctgctgcgcgccatcatcgacgccagcgcctatgcgcag
aagccggagaaccgcaaggagatcgccgaggccatcgccccggccaattatctcaacgcg
ccgcccatcgttctggagcaggtgctcaccggcacctatgcggatggcctcggcaacatc
aagaaggatccggaccgcatcaccttcgatcccttcccctatgagagcttcgcggtgtgg
atcctcacccagatgaagcgctgggggcaggtgaagggcgaggtggattatcagggcatc
gcgaagaaggtcttcctcgccaccgaagcctccaaggtgatgaaagaaatgggcctgacg
ccaccggcttccgcgaccaagaccttctcggtgatgggcaagcccttcgatccggcgaag
cccgaagactatgtggcgagcttcgccatcaagcgggcctga

DBGET integrated database retrieval system