KEGG   Azorhizobium caulinodans: AZC_0802Help
Entry
AZC_0802          CDS       T00609                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00071  Fatty acid degradation
azc00280  Valine, leucine and isoleucine degradation
azc00281  Geraniol degradation
azc00310  Lysine degradation
azc00360  Phenylalanine metabolism
azc00362  Benzoate degradation
azc00380  Tryptophan metabolism
azc00410  beta-Alanine metabolism
azc00627  Aminobenzoate degradation
azc00640  Propanoate metabolism
azc00650  Butanoate metabolism
azc00903  Limonene and pinene degradation
azc00930  Caprolactam degradation
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01212  Fatty acid metabolism
Module
azc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AZC_0802
   00650 Butanoate metabolism
    AZC_0802
  Lipid metabolism
   00071 Fatty acid degradation
    AZC_0802
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZC_0802
   00310 Lysine degradation
    AZC_0802
   00360 Phenylalanine metabolism
    AZC_0802
   00380 Tryptophan metabolism
    AZC_0802
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZC_0802
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZC_0802
   00281 Geraniol degradation
    AZC_0802
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZC_0802
   00627 Aminobenzoate degradation
    AZC_0802
   00930 Caprolactam degradation
    AZC_0802
Enzymes [BR:azc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AZC_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: BAF86800
RhizoBase: AZC_0802
UniProt: A8IQN3
Position
905244..906014
Genome map
AA seq 256 aa AA seqDB search
MAYETILVETHGKVGLIRLNRPQALNALNRQIITELNAALDAFEADTGIGCIILTGSEKA
FAAGADIKEMQDFTYPQTYLDDFIASWERLSRTRKPVIAAVAGFALGGGCELAMMCDFIL
AADTAKFGQPEIKLGVMPGAGGTQRLTRFVGKSKAMEMCLTGRFMDAAEAERAGLVSRVI
PAADLVDEALKVAAVIADMSRPVAMMTKESVNRSYETTLTEGIRFERRVFHSMFALADQK
EGMSAFVEKRKPNFGG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagacgatcctggtcgaaacccatggcaaggttggcctcatccgcctgaac
cggccgcaggcgctgaacgcgctcaatcgccagatcatcaccgagctgaatgccgccctc
gatgccttcgaggccgacacgggcatcggctgcatcatcctcaccggctcggaaaaggcc
ttcgccgccggcgccgacatcaaggagatgcaggacttcacctatccccagacctatctg
gacgacttcatcgcctcctgggagcgcctctcgcgcacccgcaagccggtgatcgcggcg
gtggcgggcttcgcgctcggcggcggctgcgaactcgccatgatgtgcgacttcatcctc
gccgcggacacggcaaagttcggccagccggagatcaagctcggcgtgatgcctggcgcc
gggggcacccagcgcctgacgcgcttcgtcggcaagtccaaggccatggagatgtgcctc
accggccgcttcatggatgcggcggaggccgaacgggccgggctcgtctcccgcgtcatt
cccgctgccgatctggtggacgaggcgctgaaggtggcggcggtcattgccgacatgtcg
cgccccgtcgccatgatgaccaaggagagcgtgaaccgctcgtacgagaccacgctcacc
gaaggcatccgcttcgagcggcgggtcttccattccatgttcgcactggcggatcagaag
gaaggcatgagcgccttcgtcgagaagcggaagccgaatttcggcggctga

DBGET integrated database retrieval system