KEGG   Azorhizobium caulinodans: AZC_0960Help
Entry
AZC_0960          CDS       T00609                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: BAF86958
RhizoBase: AZC_0960
UniProt: A8HUL3
Position
1072448..1072870
Genome map
AA seq 140 aa AA seqDB search
MRDGKRRSGWREWHAGAVVAVVMAGLGAPAALAQMALPTQAPLTGAELFKRQCGTCHTTN
AADQPRQGPTLAGVFGRKAGSVEGFRYSPGFAKADFSWDEAHLDAWLTNPQAVIPGAIMP
YRQPKPDLRAALIGYLKELK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgggatgggaaaaggcggtccggttggcgtgaatggcatgccggagccgtggtggcg
gtggtgatggcaggtctcggcgccccggcggcgctggcgcagatggcgctgccgacgcag
gcgcccctcaccggggcggagctcttcaaacgccagtgtggcacctgccacaccaccaat
gcggcggaccagccccggcaggggcccacgctggccggggtgttcggccgcaaggcggga
tcggtggaagggttccgctattcgccgggcttcgccaaggcggatttcagctgggacgag
gcgcatctcgatgcctggctcaccaatccgcaggcggtgattcccggcgcgatcatgccc
taccgccagcccaagccggacctgagggccgctttgatcggctatctgaaggagttgaag
tga

DBGET integrated database retrieval system