KEGG   Azorhizobium caulinodans: AZC_1020Help
Entry
AZC_1020          CDS       T00609                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZC_1020
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZC_1020
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZC_1020
Enzymes [BR:azc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZC_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
1144667..1145506
Genome map
AA seq 279 aa AA seqDB search
MTTRITARFTELAAEGRPGLVTFITAGDPDYDTALSILRGLPEAGADVIEVGIPFTDPMA
DGPAIQAAGLRALKGGQTLAKTLDMVRAFRDENDTTPVVLMGYYNPIYIYGVPRFIADAK
AAGVDGLIVVDLPPEEDNELCLPALDAGLDFIRLATPTTDEKRLPAVLAHTAGFVYYVSI
TGITGSATPDANAVAGAVARIKQHTTLPVAVGFGVKTPAQAAAIAAGADGVVVGSALVEA
VRKTLDEDGKATVNTVPAVTALVQELAEAVRGVNRAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcatcaccgcccgcttcacggaactcgccgccgaaggccgccccggcctc
gtgaccttcatcacggcgggcgatcccgattacgacaccgcgctttccatcctgcgcgga
ctgccggaggcgggggccgacgtgatcgaggtcggcatccccttcaccgatcccatggcc
gacggcccggccatccaggccgccggtctgcgggcactgaagggcgggcagacgctcgcc
aagacgctcgacatggtgcgggcgttccgggacgagaatgacaccacgcccgtggtgctc
atgggctactacaaccccatctacatctatggcgtgccgcgcttcatcgccgacgccaag
gcggcgggcgtggacggcctcatcgtcgtggacctgccgccggaagaggataacgagctc
tgcctgccggcgctcgacgcggggctggacttcatccgcctcgccaccccgaccacggac
gagaagcgcctgccggccgtgctcgcccatacggcgggctttgtctattacgtctccatc
accggcatcaccggctcggcgacccccgacgcgaatgcggtggcgggcgcggtggcgcgc
atcaagcagcacaccacgctgcccgtggcagtcggcttcggcgtgaagacgccggcccag
gcggcggcgatcgcggcgggtgcggatggcgtcgtggtgggctcggccctcgtcgaggcg
gtgcgcaagacgctggatgaggacggcaaggcgaccgtgaacacggttccggccgtgacg
gcgctggtgcaggaactggcggaagcggtgcgcggcgtaaatcgcgcggcggcggaatag

DBGET integrated database retrieval system