KEGG   Azorhizobium caulinodans: AZC_1082Help
Entry
AZC_1082          CDS       T00609                                 

Definition
5-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
azc  Azorhizobium caulinodans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:azc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1211786..1212595)
Genome map
AA seq 269 aa AA seqDB search
MPPMTAPADLTFLAALARIALDAGAVIRRIEANGIHAREKADASVVTDADEAAEALICPA
LRTLAPGTPIIAEEAVAAGGGVAPGRRFFLVDPLDGTREFVSGNGEYTVNIALVEDGTPR
YGIIYAPAKGLLYAGGDGAAFKALRAPEDAVVPESWTPIHCRLRPAGPIRVCASRSHSDP
STSAFIGGFEVEDCVNAGSALKFGLLAEGAVDLYPRLSPVMEWDSAAGHAIVVAAGGSVR
RPDGSPLTYGHPENDFRVNGFIAEGRPVA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcccatgaccgccccagccgacctcaccttcctcgccgctttggcccgcatcgcc
ctcgacgctggcgccgtcatccgccggatcgaggcgaacggcatccatgcgcgggagaag
gcggacgccagcgtggtgacggatgcggacgaggccgcagaggcactcatctgcccggcc
ctgcgcacgctcgcgcccggcacgcccatcatcgccgaggaagcggtcgccgccggcggc
ggggtcgcgccgggccgacgcttcttcctcgtggatccgctggacggaacgcgggagttc
gtctcgggcaatggcgagtacacggtgaacattgccttggtcgaggatggcacgccgcgc
tacggcatcatctacgcaccggccaagggcctgctctatgcgggcggcgacggcgccgcc
ttcaaggcgctgcgcgcgccggaggatgcggtggtgccggaaagctggacgcccatccat
tgccggctgcgccccgccgggcccatccgcgtctgcgccagccgctcccattcggacccc
agcaccagcgccttcatcggcggcttcgaggtcgaggattgcgtcaacgccggctcggcc
ttgaaattcggcctgctggcggaaggcgcggtggacctctatccgcgcctgtcgccggtg
atggaatgggattcggcggccggccacgccatcgtggtggccgccggcggcagcgtgcgc
cggcccgatggatcgcccctcacctacggccatccggaaaacgacttccgcgtcaacggc
ttcatcgcggaaggccggcccgtcgcctga

DBGET integrated database retrieval system