KEGG   Azorhizobium caulinodans: AZC_1206Help
Entry
AZC_1206          CDS       T00609                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
azc  Azorhizobium caulinodans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZC_1206
Enzymes [BR:azc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AZC_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1347950..1348933
Genome map
AA seq 327 aa AA seqDB search
MSSDPLAPRPVDRALDPGFRHGQSMEPNYSGVTSFLRRRYARDGGGAEVVVWGVPLDVTV
SNRPGTRFGPRALRAASSILDGDPLFPFRADPFAALDMADAGDCVFDYGLPASIPAAIEA
QAARLYATGAHLVTLGGDHFLTYPILKALVAKTGAPVALVQFDAHQDTWDDDGTRVDHGT
MITRAVKDGLIRVDRSIQVGIRTHAPQDYGIAIIDGFQAGDLGPKGIAAAIAARVGDAPV
YLSFDIDAIDPAFAPGTGTPVCGGLSSREALDTLRRLGGLDLKGFDVVEVSPPYDHADVT
ALAGASLAACYLGVLAGRKASGASIVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgatcccctggcgccgcgccctgtcgatcgcgcgctggaccccggcttccgg
catggccagtccatggagccgaactattccggcgtcacgtccttcctgcgccggcgctat
gcccgggatggcggcggcgcggaggtggtcgtgtggggcgtgcctctggacgtcaccgtc
tccaaccggccgggcacccgcttcgggccgcgcgcgctccgcgccgcctccagcatcctc
gacggcgatccgctgtttccgttccgcgccgatcccttcgccgcgctggacatggcggac
gcgggtgattgcgtgttcgattacggcctgccggcctccatccccgccgccatcgaggcg
caggcggcccgtctctatgccaccggcgcccatctggtgacgctcggcggcgatcatttc
ctcacctatccgatcctgaaggcgctggtggcaaagaccggcgcgccagtggcgctcgtc
cagttcgacgcccatcaggacacctgggacgacgacgggacccgcgtcgatcacggcacc
atgattacccgcgcggtgaaggacgggctgatccgggtggatcgctccatccaggtcggt
atccgcacccacgcgccgcaggattacggcatcgcgatcatcgacggctttcaggccggc
gatctcgggccgaaggggatcgctgccgccatcgcggcgcgcgtgggcgatgcgccggtc
tacctctccttcgatatcgacgcgatcgatcccgcctttgcgcccggcaccggcacgccg
gtctgcggggggctgtcgagccgcgaggcgctcgataccctgcgccggctcggcgggctc
gatctcaagggtttcgatgtggtggaagtctcgccgccctatgaccatgcggacgtaacg
gcactcgccggtgcatccctcgccgcctgctatctgggcgtgcttgcgggccgcaaggcc
tccggtgcatccatcgtcccttga

DBGET integrated database retrieval system