KEGG   Azorhizobium caulinodans: AZC_1217Help
Entry
AZC_1217          CDS       T00609                                 

Definition
8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
azc  Azorhizobium caulinodans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:azc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1362950..1363429)
Genome map
AA seq 159 aa AA seqDB search
MTTAYLCLGGNVGDVAATLAEAGRLLEAGGLVIRARSPLYRTPPWGPVPQPPYLNQVLAV
AGAPSPRALLTLALDVERQLGRDRAREARFGPRTADIDILAYGDETVREPDLELPHPRLL
ERAFALVPLLDIAPDIIISGTRARDALARLDRSGIERVD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcctatctctgcctcggcggcaatgtgggcgacgtggccgcgacccttgcc
gaagccggccggctgctggaggcgggcgggctggtcatccgcgcgcgctcgcccctctac
cgcacgccgccctgggggccggtgccgcagccgccctatctcaaccaggtgctcgccgtc
gccggcgccccctccccgcgcgccctgctgacgctggcgctggatgtggaacgtcagctc
ggacgggaccgcgcgcgggaggcgcgcttcggcccccgcaccgcggacatcgacatcctc
gcctatggcgacgagacggtgcgcgagccggatctggaactgccccatccgcgcctgctg
gagcgcgccttcgcgctggtgccgctgctggacatcgcgcccgacatcatcatctccggc
acacgggcgcgggacgcgctggcgcggcttgaccggagcggcatcgagcgggtggactga

DBGET integrated database retrieval system