KEGG   Azorhizobium caulinodans: AZC_1250Help
Entry
AZC_1250          CDS       T00609                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: BAF87248
RhizoBase: AZC_1250
UniProt: A8I0F1
Position
complement(1400316..1400783)
Genome map
AA seq 155 aa AA seqDB search
MRHPLLSIALGVGIGACAVALAWRFWPGFAPSQRPPRPVPENATLADLLRDADPAAGAQV
FRICGSCHSVGRAGGNLDGPNLHGVMGSLIGRNSPRFSYTAALQAVGGRWTLERMDAWLK
DPQAFAPGTSMGFAGLESARDRADVIAYLMRQTGP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaccccctcctctccatcgctctcggcgtcggcatcggcgcctgcgcggtcgct
ctggcatggcggttctggccgggcttcgcgccgagccagcgcccgccccggccggtgccg
gaaaacgccaccctcgccgacctgctccgcgatgcggacccggccgccggagcgcaggtc
ttccgcatctgcggatcctgccattccgtcggacgcgccggcggcaatctcgacggaccg
aacctccatggcgtgatgggcagcctgatcggccggaacagcccgcgcttcagctacacc
gctgccctgcaagcggtgggcggacgctggacgctcgagcggatggatgcctggctgaag
gacccgcaagcctttgcgcccggcaccagcatgggctttgccgggcttgagtccgcccgc
gaccgggccgacgtcatcgcctacctgatgcggcagacggggccctga

DBGET integrated database retrieval system