KEGG   Azorhizobium caulinodans: AZC_1301Help
Entry
AZC_1301          CDS       T00609                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01183  
chitinase [EC:3.2.1.14]
Organism
azc  Azorhizobium caulinodans
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZC_1301
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_1301
Enzymes [BR:azc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AZC_1301
    3.2.1.14  chitinase
     AZC_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1449413..1454920
Genome map
AA seq 1835 aa AA seqDB search
MADTSTSSGRIFVVDTAGADIIGFDPAKDKLNLGDNSVHNFIVVDTPTGVGFMNPWSGET
LIVQGVSLAQLTIDSFVPIVNDHLRQTLSGALAWEHGIVPAPHTVYARSHELGQIDKVAF
DPATDVVDFRYFGTREQIYMSDSSEGVIISNSGTGQALILLGVTKAQLTVNNFVFYSAEV
REDRVHLQLGFTTVPDSQVIPQGVEIAGTNTWPTAAGSGEAPSGVTGTTYKIEWHYDSST
TLAFNPAVDKLDFGWFKANEFDISEVNGSTVISITNNHQTYTLTGVKIGALAINNIIALD
TSARAEWQSTIDAAPKPVAPPVINLSDAQVVEGDAGAAQMLFTVSLSHAADGPVSVSYST
LNGTATAGTDYTSAVGTVTFAAGETQKTIAIAVTGDTLHELNEAFSLQLSAPSGATINDG
SAVGTIIDNDPDPSPGVPPKISIADISVVEGNTDMAHFRFQVTLDKASTETITVHYASSD
LTATGGTDYEILDGTLTFAPGETTQTIHAHMYSDTVVEPDETYKVNLSNPTNATIADGTA
IATIVNDDLAAPLPTLALADAAISEGNSGSKLLSFTVTLSAASATAVSVSYATGDGTATG
GSDYTAGTGTVTFAPGETSKTIQVAVKGDTVVEANETFTVTLSAPSGATIADGSAIGTIT
NDDVAVVVPTVSIADASVVEGNSGTTALSFVVSLSAASTSAVSVSYATANGTATAGSDYT
AKTGTVTFAPGETSKTIQVAVTGDTAVEANETFTVALSSPSGATLGHGTATATITNDDVS
STPGGGAVVDYSVTSNWGAGFTAAMTVEAGAGALAGWTVEFDAGFTITNIWNATIVSHVG
THYVLKNMSYNASVGAGKDTSFGFQATAGSGGTAASGFLINGQPSGGGLPPTLPTLSVSD
ASVLEGNSGTSDLAFTVALSAASATAVTVAYGTANGTATAGSDFTAASGTLTFAPGETSK
VVHVAVTGDRTVEANETLALKLSAPTGATLVRATATGTITNDDAAVVVPTVSVSDASVTE
GNSGTKDLVFNVTLSQAATGPVTLRYATADGTATAGSDYGATSGTLTFAAGETSKQVHVQ
VTGDTLVEGNETLSLTLSSPTGATIADGSGAGLITNDDVAPVVPTVSVADASVNEGASGI
TDLAFTVSLSKATTAPVSLHYATADGTATAGSDYVAGSGTITFAAGETSKVVHVQVNGDT
AVEANETLKLILSQPAGATIATGTATGTIVNDDVTPGGGTPAVSIGDVTVTEGNPAVATA
TGWFSTSGNQIIDADGNSVQIAGVNWFGFESNTGSPHGLWTRGYKEMMQQMLDEGFNTIR
LPFSSDMLHSTGQAGSIDYSKNPDLKGLTSLQVMDKIVQYADEIGIKIILDHHRSSAGDG
TSANGLWYDSSHSEASWIADWQMLATRYAGDTSVIGADLHNEPYNGTWGDGGTNDWARAA
TAAGNAIGAVNDNWLIFVEGIGTYQGQNYWWGGNLMGVRDHPIELNVDNKLVYSAHDYPN
SVYAQPWFQGANFAADLPAKFDQMWGFIYKEQIAPVYIGEFGTKLTDPKDVAWFKAITAY
LGGDFNNDGVKDISAGEHGPSWTFWSWNPNSSDTGGILQNDWSTVNENKMVYLTPIEAPF
PALDGSGGGVPGVHADFQVTLSQAASTAVSVEYHTVAPDAASAADFTASSGTVVFQPGET
TKVISIAITADKAAEATEHFAVVLSNPVGVSVAKGTGTGTILDNDGTPSSPTTPTTPTHT
DLHGTLTVVDAWNSGFNANISLHNDGTIPTSGWQVKVEMPNEISSIWNAQILSHDADGYV
IGNAAWNGTVGADAEISFGFTATGHLDPTHVGLLF
NT seq 5508 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaccagcacctcttccggccgcatcttcgtggtggataccgcaggcgcggac
atcatcgggttcgatccggccaaggacaagctgaacctgggcgacaattcggttcataat
ttcatcgttgtcgacacccccaccggggtcggcttcatgaatccgtggtcgggggagacg
ctgatcgtccagggcgtttcgctggcgcaactgaccatcgacagcttcgtgccgatcgtg
aacgaccatctgcgccagaccctctccggcgcgctggcttgggaacacggcatcgttccg
gccccgcacacggtctatgcccgctcgcacgaactcgggcagatcgacaaggtggcgttc
gacccggccaccgacgtggtggacttccgctatttcggcacccgtgaacagatctatatg
agcgacagctcagagggcgtcatcatctccaattccggcaccggtcaggcgctgattctg
ctgggggtgaccaaggcgcagctcaccgtcaacaatttcgtgttttactctgccgaggtg
cgcgaagaccgggtgcatttgcagctgggcttcactaccgtgccggacagccaggtcatc
ccccagggcgtggagatcgccggcaccaatacctggcccaccgccgccggcagcggcgag
gcgccgagcggcgtcaccggcaccacctacaagatcgaatggcattacgacagcagcacc
acgctggcgttcaatccggccgtggacaagctcgatttcggctggttcaaggccaatgaa
ttcgacatcagcgaggtgaacggttccaccgtcatctccatcaccaataaccaccagacc
tatacgctcacgggcgtgaagatcggtgcgctggcgatcaacaatatcatcgccctcgac
acctccgcccgcgccgaatggcagagcaccatcgatgccgcgcccaagcccgtggcgccg
ccggtcattaacctgtccgacgcgcaagtggtggaaggcgatgccggcgcggcgcagatg
ctgttcaccgtgtccttgtcccatgcggcggacgggccggtgagcgtcagctattccacc
ctcaacggcaccgccaccgccggcacggattatacgtccgccgtgggcacggtgacgttc
gccgccggcgagacgcagaagaccatcgccatcgccgtcaccggcgacacgctgcacgag
ctcaacgaggcgttcagcctgcaattgtccgcgccgtccggtgccaccatcaatgacggc
tcggcggtgggcaccatcatcgacaatgatcccgaccccagccccggcgtgccgccgaag
atttccatcgccgacatctcggtggtggagggcaatacggacatggcccatttccgcttc
caggtgacgctggacaaggcctccaccgagaccataacggtgcattacgcctcgtccgat
ctcaccgccaccggcggcaccgattacgagatcctggacggcacgctcaccttcgcaccg
ggcgagaccacccagaccatccacgcccacatgtatagcgacaccgtggtggagccggac
gagacctacaaggtcaatctgtccaaccccaccaatgccaccatcgccgacggcaccgcc
atcgccaccatcgtcaatgacgatctggcggcgcccctgcccacgctcgccctcgccgat
gcggccatcagcgagggcaacagcggcagcaagctgctgagcttcacggtcactctctcg
gccgccagcgcgacggcggtgagcgtgagctacgccaccggcgacggcaccgccaccggc
ggttcggactacaccgccggcaccggcacggtgactttcgccccgggcgagacctccaag
accatccaggtggcggtgaagggcgacacggtggtggaggccaacgagaccttcacggtg
acgctctcggccccctccggcgccaccatcgccgacggctcggccatcggcaccatcacc
aatgacgatgtggcggtggtggtgcccaccgtgtccatcgccgacgcgtccgtggtggag
ggcaattccggcaccacggcgctgagcttcgtggtgagcctctcggcggccagcacgtcg
gcggtgagcgtgagctatgccaccgccaatggcactgcgacggcgggctcggactacacc
gccaagacgggcaccgtgaccttcgccccgggcgagacctccaagaccatccaggtggcg
gtgaccggcgacacggcggtagaggccaacgagaccttcaccgtcgcgctgtcatccccc
tccggcgccacgctcggccatggcaccgccaccgccaccatcaccaatgacgatgtgtcg
agcaccccgggcggcggggccgtggtggactacagcgtcaccagcaactggggggcgggc
ttcaccgccgccatgaccgtggaggccggcgccggcgcgcttgcgggctggacggtggaa
ttcgacgccggcttcaccatcaccaacatctggaatgccaccatcgtcagccatgtgggc
acccattatgtgctgaaaaacatgagctataacgccagcgtgggggcggggaaggacacg
tccttcggcttccaggccaccgccggctcaggcggcacggcggcgagcggcttcctcatc
aatggccagccctccggcggtggcttgcccccgacgctgcccaccctgtcggtgtcggac
gcttcggtgctggaaggcaattccggcacctcggatctggccttcaccgtggccctctcg
gcggcctcggccacggcggtgaccgtggcctatggcaccgccaacggcaccgccacggcg
ggctcggatttcaccgccgcctccggcaccctgaccttcgcgccgggggaaacctccaag
gtggtgcatgtggccgtcaccggcgaccgcacggtggaagccaacgaaaccctcgcctta
aagctctccgcgcccaccggggcgacgctggtgcgcgccaccgccaccggcaccatcacc
aatgacgatgcggcggtggtggtgcccaccgtgtccgtctccgatgccagcgtcaccgag
ggcaattccggcaccaaggatttggtgttcaatgtcaccctgtcgcaggccgccaccggg
ccggtgaccttgcgctatgccacggcggacggcaccgccaccgccggctccgactatggg
gccacctcgggcacgctcaccttcgcagcgggggagacctccaagcaggtgcatgtgcag
gtgacgggcgacacgctggtggagggcaacgagaccctctctctcacactctcctcgccc
acgggcgccaccatcgccgatggctccggcgcgggcctgatcaccaatgacgacgtggcc
ccggttgtgccaacggtgtcggtggccgatgccagcgtcaacgagggcgcgtccggcatc
acggacctggccttcaccgtgtcgctgtccaaggccaccaccgcgccggtgtccttgcac
tatgccacggcggacggcaccgccaccgccggctccgattatgtggcgggctcgggcacg
atcaccttcgcggcgggcgagacctcgaaggtggtgcatgtgcaggtcaatggcgacacg
gcggtggaagccaatgagacgctgaagctgatcctctcccagcccgccggcgccaccatc
gccacaggcacggccaccggcaccatcgtcaatgacgacgtgacgccgggcgggggaacg
cccgccgtgtccatcggcgacgtcaccgtgaccgaaggcaatccggcggtcgccaccgcc
accggctggttcagcacctctggcaaccagatcatcgatgccgatggcaacagcgtgcag
atcgccggggtgaactggttcgggttcgaatccaacaccggctcgccgcacggcttgtgg
acccgaggctataaggagatgatgcagcagatgctggatgaagggttcaacaccattcgt
ctgcctttctccagcgacatgctccattccaccggccaggccggcagcatcgactattcc
aagaacccagatctcaagggcctgacctcgctgcaggtgatggacaagatcgtccaatat
gcagacgagatcggcatcaagatcatcctcgaccaccaccgcagcagcgccggcgacggc
acctcggccaacggcctgtggtacgactcgagccattctgaagcctcctggatcgccgac
tggcagatgctggcgacccgctatgccggcgacacctccgtcatcggcgccgatctccac
aacgagccctataacggcacctggggcgacggcggcaccaatgactgggcccgcgccgcc
accgccgccggcaatgccatcggtgccgttaatgacaactggctcattttcgtcgagggc
attggcacctaccagggccagaactattggtggggcggcaatctgatgggcgtgcgcgac
catcccatcgagctgaacgtggacaacaagctggtctattcagcccacgattatcccaac
tcggtctatgcccaaccctggttccagggtgcgaacttcgccgccgatctgccggccaag
ttcgaccagatgtggggcttcatctacaaggagcagatcgccccggtctatatcggcgag
tttggcaccaagctcaccgaccccaaggacgtggcctggttcaaggccatcaccgcctat
ctcggcggcgacttcaacaatgacggcgtgaaagacatctccgccggcgagcacgggccg
agctggaccttctggtcgtggaaccccaactcctccgacaccggcggcatcctccagaac
gactggtcgacggtgaacgagaacaagatggtctatctcacgccgatcgaggcgccgttc
ccggcgctggacggcagcgggggaggggtgcccggcgtccatgcggatttccaggtgaca
ttgtcgcaagccgcgtccaccgcggtaagcgtcgagtatcataccgtggcccctgacgcg
gcctccgcagccgacttcaccgcgtcgagcggcacggtagtgttccagccgggtgagacg
accaaggtgatctccatcgccatcaccgccgacaaggcggccgaggcgaccgagcatttc
gccgtcgtactcagtaatcccgtgggcgtttccgtcgccaagggaacggggaccggcacc
atcctcgataatgacggtacgccgtcctcccccacgacgcccacaaccccgacccacacg
gatctgcacgggacactcacggtggtcgatgcctggaacagtgggttcaacgcgaacatc
tccctccacaatgacggaacgatcccgacctccggctggcaggtgaaagtggagatgccg
aacgagatttccagcatctggaacgcgcagatcctgtcccacgacgcggacggctacgtg
atcggcaacgccgcgtggaacggcaccgtgggcgccgatgcggagatcagcttcggcttc
accgctaccggccatctggatcccacccatgtggggctgctcttctga

DBGET integrated database retrieval system