KEGG   Azorhizobium caulinodans: AZC_1543Help
Entry
AZC_1543          CDS       T00609                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
azc  Azorhizobium caulinodans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:azc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1754931..1755860)
Genome map
AA seq 309 aa AA seqDB search
MREHTLTVDDLIWPIFVVEGEKVRENVASMPGVERLSIDEAVRAAEMAAKLRIPALALFP
YTEPGLRDPHGSEALNDNNLVCRALRAIKARVPEIGLITDVALDPYTSHGHDGLMDGERI
VNDATVEVLVRQSIVQAQCGADVIAPSDMMDGRVGAIRLGLDKAGFEDVQIMSYAAKYAS
AFYGPFRDAIGTSKTLIGDKRTYQMDPANGAEAIREAALDVEEGADMLMVKPGLPYLDVV
YRLKEAFALPTYAYQVSGEYAMIEGAIRNGWLDGSRVVEESLIAFKRAGADGILTYFAPR
VAERLAAGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaacacacgctcaccgtcgatgacctgatctggccgatcttcgtcgtcgaaggc
gagaaggtgcgcgagaatgtggcctccatgccgggcgtcgagcgcctgtccatcgacgag
gcggtgcgcgcagcggaaatggcggcaaagctgcgcattcccgccctcgcgctcttcccc
tacacagagccgggcctgcgcgatccgcacggctccgaggcgctgaacgacaacaatctc
gtctgccgcgcgctgcgcgccatcaaggcccgcgtgccggagatcggcctcatcaccgac
gtggcgctcgatccctacaccagccatggccatgacggcctcatggacggcgagcgcatc
gtcaatgacgcgacggtggaagtgctggtgcgccagtccatcgtccaggcccaatgcgga
gccgatgtgatcgccccctccgacatgatggatggccgcgtcggcgccatccgcctcggc
ctcgacaaggcgggcttcgaggacgtgcagatcatgtcctatgcggccaagtacgcgtcg
gccttctatggtccgttccgcgatgccatcggcacctccaagaccctcatcggcgacaag
cgcacctatcagatggaccccgccaatggcgcggaagccatccgggaagccgcccttgat
gtggaggagggcgccgacatgctgatggtgaagcccggcctgccctatctggacgtggtc
tatcgcctgaaggaggccttcgcgctgcccacctatgcctatcaggtgtccggcgagtac
gcgatgatcgagggcgccatccgcaacggctggctcgacggcagccgcgtggtggaggag
agcctcatcgccttcaagcgggcgggtgccgacggcatcctcacctacttcgccccgcgc
gtggccgagcggctcgccgccggcgcgtga

DBGET integrated database retrieval system