KEGG   Azorhizobium caulinodans: AZC_1543Help
Entry
AZC_1543          CDS       T00609                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
azc  Azorhizobium caulinodans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZC_1543
Enzymes [BR:azc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AZC_1543
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZC_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1754931..1755860)
Genome map
AA seq 309 aa AA seqDB search
MREHTLTVDDLIWPIFVVEGEKVRENVASMPGVERLSIDEAVRAAEMAAKLRIPALALFP
YTEPGLRDPHGSEALNDNNLVCRALRAIKARVPEIGLITDVALDPYTSHGHDGLMDGERI
VNDATVEVLVRQSIVQAQCGADVIAPSDMMDGRVGAIRLGLDKAGFEDVQIMSYAAKYAS
AFYGPFRDAIGTSKTLIGDKRTYQMDPANGAEAIREAALDVEEGADMLMVKPGLPYLDVV
YRLKEAFALPTYAYQVSGEYAMIEGAIRNGWLDGSRVVEESLIAFKRAGADGILTYFAPR
VAERLAAGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaacacacgctcaccgtcgatgacctgatctggccgatcttcgtcgtcgaaggc
gagaaggtgcgcgagaatgtggcctccatgccgggcgtcgagcgcctgtccatcgacgag
gcggtgcgcgcagcggaaatggcggcaaagctgcgcattcccgccctcgcgctcttcccc
tacacagagccgggcctgcgcgatccgcacggctccgaggcgctgaacgacaacaatctc
gtctgccgcgcgctgcgcgccatcaaggcccgcgtgccggagatcggcctcatcaccgac
gtggcgctcgatccctacaccagccatggccatgacggcctcatggacggcgagcgcatc
gtcaatgacgcgacggtggaagtgctggtgcgccagtccatcgtccaggcccaatgcgga
gccgatgtgatcgccccctccgacatgatggatggccgcgtcggcgccatccgcctcggc
ctcgacaaggcgggcttcgaggacgtgcagatcatgtcctatgcggccaagtacgcgtcg
gccttctatggtccgttccgcgatgccatcggcacctccaagaccctcatcggcgacaag
cgcacctatcagatggaccccgccaatggcgcggaagccatccgggaagccgcccttgat
gtggaggagggcgccgacatgctgatggtgaagcccggcctgccctatctggacgtggtc
tatcgcctgaaggaggccttcgcgctgcccacctatgcctatcaggtgtccggcgagtac
gcgatgatcgagggcgccatccgcaacggctggctcgacggcagccgcgtggtggaggag
agcctcatcgccttcaagcgggcgggtgccgacggcatcctcacctacttcgccccgcgc
gtggccgagcggctcgccgccggcgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system