KEGG   Azorhizobium caulinodans: AZC_1648Help
Entry
AZC_1648          CDS       T00609                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AZC_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1887018..1887896
Genome map
AA seq 292 aa AA seqDB search
MMAIIDRSFMIEGGPVGVLLIHGLGGTPVEMREVARALAAGGHTVLCCQLAGHGGSMDDL
TSTGFEDWYDSALAGLATLEQRCERVVVGGLSMGAVLAALLAARQPERVAGLVMLAPTLR
YDGWSIPWYSFLLPLLINTPIGRRYQFEEREPYGVKDERVRAVIVRALRQGSGDAGLTAT
PSAALRELWRLVAALRPLLGAIRQRTLLVHARHDDVASLRNALYLQRHLGGPVDSLILED
SYHLVTLDRQRHLVTERVLSFVDALTAPKSNPKARRPAARAALVPQEMGHVA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatggccatcatcgaccgcagtttcatgatcgagggcgggcccgtgggcgtcctgctc
attcacggtctcggcggcacgccggtggagatgcgggaggtcgcccgtgccctcgctgcc
ggtggccacacggtgctgtgctgccaactggccggccatggcggctccatggacgatctc
accagcaccggcttcgaggactggtacgacagcgcgctcgcgggcctcgccacgctggag
cagcgctgcgagcgcgtggtggtcgggggcctctccatgggggcggtgctcgcggcgctc
ctggcggcgcgccagccggagcgggtcgccggcctcgtcatgctggcgccgacgctgcgc
tatgatggctggtcgatcccctggtacagcttcctgctgcccctgctcatcaacacgccc
atcggccggcgctaccagttcgaggagcgggagccttacggagtgaaggacgagcgcgtg
cgggcggtgatcgtgcgagccctgcgacagggcagcggcgatgccggcctcaccgccacg
ccctctgccgcccttcgggaactgtggcgcctcgtcgccgcgctgcgtccgctgctgggg
gccatccgccagcgcacgctgctcgtgcacgcccggcacgatgatgtggcaagcctgcgc
aacgccctctatctccagcgccatctcggcgggccggtggacagccttatccttgaggac
agctatcatctcgtcaccctcgaccggcagcggcatctggtgaccgagcgcgtcctgagc
ttcgtcgatgcgctcaccgcgccgaagtcgaacccgaaggcgcgccgcccggccgcccgc
gccgccctcgtgccgcaggagatgggccatgtcgcatga

DBGET integrated database retrieval system