KEGG   Azorhizobium caulinodans: AZC_1728Help
Entry
AZC_1728          CDS       T00609                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AZC_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1977779..1978480
Genome map
AA seq 233 aa AA seqDB search
MGREGALQSHRQGALGMTDSEAERAERAAFILSLRRRGIRDLAVLRALELVPRGLFVDPT
LRRHAYEDVALPIACGQTMSQPSLVALMTEALALNAEHTVLEIGTGSGYQAAVLSHLAAQ
VVTMDRYRALVGEAQTRFQVLGLRNVAAFVGDGTQGLPGRAPYDRIMITAATGEVPRALV
DQLKPGGVLIAPIGAPREVQKLRRFIKDGGNLEASDLMDVRFVPLVAGVAALL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgaaggtgctttacagtcgcatcgtcagggggcgcttggcatgaccgacagt
gaagccgaacgggcggagcgggccgccttcatcctcagcctgcggcggcggggcatccgg
gatctggcggtgctgcgggcgctggagctggtgccgcgcggcctcttcgtggacccgact
ttgcgtcgccatgcctatgaggatgtggcactccccatcgcctgcgggcagaccatgtcc
cagccgagcctcgtcgccctgatgaccgaggcactcgcgctcaatgccgagcatacggtg
ctcgagattggcacggggtcgggctatcaggccgccgtcctctcccatctcgcggcgcag
gtggtgaccatggaccgctaccgggcgctggtgggcgaggcgcagacgcgctttcaggtg
ctcggcctgcgcaacgtcgccgccttcgtgggggacggcacgcagggcctgccgggccgc
gcgccctatgatcgcatcatgatcaccgccgcaaccggggaggtgccccgcgcgctggtg
gatcaactgaaaccgggcggcgtcctcatcgcccccatcggcgcgccccgcgaggtgcag
aagctccgccggttcatcaaggatggcggcaaccttgaggcgagcgacctcatggacgtg
cgcttcgtgccgctggtcgccggggtggccgcgctgctctga

DBGET integrated database retrieval system