KEGG   Azorhizobium caulinodans: AZC_1732Help
Entry
AZC_1732          CDS       T00609                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
azc  Azorhizobium caulinodans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:azc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:azc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1983654..1984682
Genome map
AA seq 342 aa AA seqDB search
MTFAPSGTRALIVGLSGLRLTEGERDFLRAVRPWGLILFARNVDTPEQVAHLVAEGREVL
GWRAPVLIDQEGGRVQRLRPPFWIDYPPAEQFGAIYKADKARALKAVHLNSRLIAADLAA
LGIDVDCLPVADLRLPEGHGVIGNRAYGSEPSTVAALASAAARGLMEGGVLPVLKHIPGH
GRAPADSHEHLPTVTASRSELEATDFAAFMSLNTLPLGMTAHVVYAAIDKHNPATTSRVV
LDDVVRGFIGFDGALMSDDLSMKALSGSFAERARASIAAGCDLLLHCNGQMDEMRAVASE
SPLLAGAAAERAARALARRIDPPATDLDAIRDELAVLLEQPV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgccccttccggaacccgcgccctcattgtcggcctctccggcctccgcctc
accgagggcgagcgcgatttcctgcgcgcggtgcgcccctggggcctcatcctgttcgcc
cgcaacgtggatacgcccgagcaggtagcccatctggtggccgaagggcgcgaggttctg
ggctggcgcgcgccggtgctcatcgatcaggaaggcggccgggtgcagcgcctgcgcccg
ccgttctggatcgactatccccccgccgagcagttcggcgcgatttacaaggcggacaag
gcccgcgcgctgaaggcggtccacctcaactcccgcctcatcgccgccgatctcgccgct
ctcggcatcgacgtggactgcctgccggtggcggacctgcgcctgccggaaggccatggc
gtcatcggcaaccgggcctatggaagcgagccgtccacggtcgccgcgctggcgagtgcc
gccgcgcgcggcctcatggagggcggcgtcctgccggtgctcaagcacatccccggccac
ggccgtgccccggcggacagccacgagcatctgcccaccgtcaccgccagccgttcggag
ctggaggcgacggactttgccgccttcatgtcgctgaacaccctgccgctcggcatgacc
gcccacgtggtctatgctgccatcgacaagcacaaccccgccaccacctcgcgcgtcgtg
ctggatgatgtggtgcgcggttttatcggcttcgacggggcgctgatgagcgatgacctg
tccatgaaggcgctctccggctcgttcgccgagcgcgcccgcgcgtccatcgccgccggc
tgcgatctgctgctccattgcaacggccagatggacgagatgcgcgcggtggcgagcgag
agcccgctgctggccggcgctgccgccgagcgggcggcgcgggcgctcgcccgccgcatc
gatccgccggccaccgatctcgacgccatccgcgacgagctggccgtgctgctcgaacag
ccggtctga

DBGET integrated database retrieval system