KEGG   Azorhizobium caulinodans: AZC_1732Help
Entry
AZC_1732          CDS       T00609                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
azc  Azorhizobium caulinodans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_1732
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AZC_1732
Enzymes [BR:azc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AZC_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1983654..1984682
Genome map
AA seq 342 aa AA seqDB search
MTFAPSGTRALIVGLSGLRLTEGERDFLRAVRPWGLILFARNVDTPEQVAHLVAEGREVL
GWRAPVLIDQEGGRVQRLRPPFWIDYPPAEQFGAIYKADKARALKAVHLNSRLIAADLAA
LGIDVDCLPVADLRLPEGHGVIGNRAYGSEPSTVAALASAAARGLMEGGVLPVLKHIPGH
GRAPADSHEHLPTVTASRSELEATDFAAFMSLNTLPLGMTAHVVYAAIDKHNPATTSRVV
LDDVVRGFIGFDGALMSDDLSMKALSGSFAERARASIAAGCDLLLHCNGQMDEMRAVASE
SPLLAGAAAERAARALARRIDPPATDLDAIRDELAVLLEQPV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgccccttccggaacccgcgccctcattgtcggcctctccggcctccgcctc
accgagggcgagcgcgatttcctgcgcgcggtgcgcccctggggcctcatcctgttcgcc
cgcaacgtggatacgcccgagcaggtagcccatctggtggccgaagggcgcgaggttctg
ggctggcgcgcgccggtgctcatcgatcaggaaggcggccgggtgcagcgcctgcgcccg
ccgttctggatcgactatccccccgccgagcagttcggcgcgatttacaaggcggacaag
gcccgcgcgctgaaggcggtccacctcaactcccgcctcatcgccgccgatctcgccgct
ctcggcatcgacgtggactgcctgccggtggcggacctgcgcctgccggaaggccatggc
gtcatcggcaaccgggcctatggaagcgagccgtccacggtcgccgcgctggcgagtgcc
gccgcgcgcggcctcatggagggcggcgtcctgccggtgctcaagcacatccccggccac
ggccgtgccccggcggacagccacgagcatctgcccaccgtcaccgccagccgttcggag
ctggaggcgacggactttgccgccttcatgtcgctgaacaccctgccgctcggcatgacc
gcccacgtggtctatgctgccatcgacaagcacaaccccgccaccacctcgcgcgtcgtg
ctggatgatgtggtgcgcggttttatcggcttcgacggggcgctgatgagcgatgacctg
tccatgaaggcgctctccggctcgttcgccgagcgcgcccgcgcgtccatcgccgccggc
tgcgatctgctgctccattgcaacggccagatggacgagatgcgcgcggtggcgagcgag
agcccgctgctggccggcgctgccgccgagcgggcggcgcgggcgctcgcccgccgcatc
gatccgccggccaccgatctcgacgccatccgcgacgagctggccgtgctgctcgaacag
ccggtctga

DBGET integrated database retrieval system