KEGG   Azorhizobium caulinodans: AZC_1809Help
Entry
AZC_1809          CDS       T00609                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00010  Glycolysis / Gluconeogenesis
azc00620  Pyruvate metabolism
azc00640  Propanoate metabolism
azc00680  Methane metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_1809
   00620 Pyruvate metabolism
    AZC_1809
   00640 Propanoate metabolism
    AZC_1809
  Energy metabolism
   00680 Methane metabolism
    AZC_1809
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZC_1809
Lipid biosynthesis proteins [BR:azc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZC_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAF87807
RhizoBase: AZC_1809
UniProt: A8I538
Position
complement(2069581..2071194)
Genome map
AA seq 537 aa AA seqDB search
MLPEAARYDDLVRAFRWRIPERFNIGTACVDAHADGSGKPALLFVEESGALVTYTFDELK
RLTNRFANVLAACGLERGDRLAVFLPQAPETAIAHLAAFKAGLVSVPLFTLFGDEALSFR
LANSGAKALVTDLAGLAKLDRIRHEVPDLTHVFVTGPDQGDGRAISFDAAMARASDAFTP
SDTGPDDPAIIIFTSGTTGNPKGALHGHRILLGHLPCIEFIHQGMPQPGDLHWTPADWAW
IGGLFDVLFPTLYLGVPVLAHRAKKFDPDAAMALMATHKVRNVFLPPTALKLLRQADVRH
PGLVLRSLLTGGETLGAELGAFVQERLGVEAREIYGQTECNLVVGSNSNFFAIRPGAMGK
PIPGHDVRIVDEDGVEVPTGEQGHIGVRRGDPVMMLEYWNNPAATADKYAGDFLLTGDLG
RQDEEGYLWYMSRSDDVITSAGYRIGPGEIEDCILRHPAVAMVGVVGVPDPVRTEAIKAW
VVLKPGQLGSDALAAEIQDHVRTRLSGHEYPRYVSFTDALPMTATGKILRRELRRLG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgaggccgcgcgctatgacgatctcgtccgagccttccgctggcggattccc
gagcgcttcaacatcggcaccgcctgcgtcgatgcccatgcggacggatcgggaaagccg
gcgctgctgttcgtggaggaaagcggcgcactcgtcacctacacgttcgacgaactgaag
cgcctcaccaaccgcttcgccaatgtgctcgccgcctgcggactggagcggggagatcgg
ctggctgtgttcctgccgcaggcgcccgagacggccatcgcgcatctggcggccttcaag
gcggggctggtctcggtgccgctgttcaccctctttggcgatgaggcactctccttccgg
ctcgccaattcgggcgcgaaggcgctggtgacggaccttgcgggcctcgccaaactggac
cgtatccggcacgaggtgcccgacctcacccatgtgttcgtcaccggtccggatcagggc
gacgggcgggccatctccttcgacgccgccatggcccgcgcatcggacgccttcaccccc
tccgacacagggccggacgatccagccatcatcatcttcacctcgggcaccaccggaaat
cccaagggcgctctgcacggccaccgcatcctgctcgggcatctgccgtgcatcgaattc
atccaccaagggatgccgcagccgggtgacctgcactggacgcccgcggactgggcgtgg
atcggcggccttttcgacgtgctgtttccgaccctctatctcggcgtgcccgtgctcgcg
caccgggcgaagaagttcgatcccgatgcggcgatggcgctgatggcgacgcacaaggtg
cgcaacgtcttcctgccgcccaccgcgctcaagctgctgcggcaggcggacgtacgacac
cccggcctcgtcctgcgctccctgctgacgggtggcgagacactgggcgcggagctcggc
gccttcgtgcaggagcgcctgggcgtcgaagcgcgggagatctacggccagaccgaatgc
aatctggtggtcggctccaactcgaacttcttcgcgatccgccccggcgccatgggcaag
ccgattcccggtcacgacgtacgcatcgtggacgaggacggcgtggaggtgccgacgggc
gagcagggccatatcggcgtgcgccggggcgacccggtgatgatgctggaatactggaac
aaccccgcggccaccgccgacaaatacgccggcgacttcctcctgaccggcgacctcggc
cggcaggacgaggagggctacctctggtacatgagccgctcggacgatgtcatcacgtcc
gcgggctaccgcatcgggcccggcgagatcgaggactgcatcctgcgccatccggccgtc
gccatggtgggcgtcgtgggcgtgccggacccggtccgaacggaagccatcaaggcctgg
gtggtgctgaaaccgggtcaactcggctcagacgcgctggcggcggaaattcaggaccat
gtgcgcacccgcctttccgggcacgaatatccccgctacgtttccttcaccgacgcgctg
cccatgacggcgaccggcaagatcctgcgccgcgagctgcgccgcctcggttga

DBGET integrated database retrieval system