KEGG   Azorhizobium caulinodans: AZC_1907Help
Entry
AZC_1907          CDS       T00609                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_1907
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_1907
   00020 Citrate cycle (TCA cycle)
    AZC_1907
   00620 Pyruvate metabolism
    AZC_1907
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZC_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2185099..2186214)
Genome map
AA seq 371 aa AA seqDB search
MNARINPIVMPKWGLSMAEGKVTGWLVRPGAKITAGDEILEVETDKIAGVVEAGEAGTLR
RVLGEPQTVYPVKALIGVIADDDVPDAEIDAFVAAYAVPAEEGEDAAEAGPRYEFVETPA
GRLRYARRGEGEDTVLLIHGFGGDLDNWLFNIDALGAAATVYALDLPGHGQSEKALGDPS
LPGLATAVLGFMDALGIARAHLVGHSMGGALAQRVAVDAPSRVASIALIASAGLGPEING
DYIAGFVSAAGRRELKPVLEHLFHDPSTVTRQLVDDVLKYKRIDGVDTALRALADGLFPD
GRQASQLADRTRAAGTRTLVVFGEGDRIIPAAHAQALADTAQVHVLPEAGHMVQMEKAGR
VNELLLKHIAG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcgtatcaatcccattgtcatgcccaagtgggggctctccatggcggagggc
aaggtgacgggctggctcgtccggcctggcgcgaagatcaccgccggcgacgagatcctc
gaagttgagacggacaagattgccggggtggtcgaagccggcgaggccggcactctgcgg
cgcgtcctcggcgagccccagacggtctatcccgtgaaggcgctcatcggcgtcatcgcg
gacgatgatgtgcccgatgcggagatcgacgcctttgtcgccgcttatgccgtgcctgcc
gaggagggggaggacgccgcggaggccgggccacgctatgaattcgtcgaaacgccggcc
gggcgcctgcgctatgcccgccgcggcgagggcgaggatacggtactgctgatccacggc
ttcggcggcgatctcgacaactggctgttcaatatcgacgctttgggcgccgccgccacc
gtctatgccctcgatcttccgggccatgggcaatcggagaaggcgctcggcgaccccagc
ctgccgggcctcgcgacggccgtgctcggcttcatggatgccctcggcatcgcgcgcgcc
catctggtgggccattccatgggcggcgcgctcgcccagcgggtggcggtcgatgcgccg
tcccgtgtggcctcgattgccctcattgcatcggccgggctcgggccggagatcaatggc
gattacatcgccggcttcgtttcggccgccggacggcgtgagctcaagcccgtgctggaa
catctcttccacgacccgtccaccgtgacgcggcagttggtggacgacgtgctgaaatac
aagcgcatcgatggtgtcgatacggccctgcgggcgcttgcggacggcctctttcccgat
ggccggcaggccagccagctcgccgaccggacacgcgcagcggggacacgcacgctcgtc
gtcttcggcgagggcgaccgcatcattcccgccgcccacgctcaggcgctcgcggacact
gcgcaggtgcatgtactgccggaggccgggcacatggtgcagatggaaaaggccgggcgg
gtcaacgaactcctgctcaagcacatcgccggctga

DBGET integrated database retrieval system