KEGG   Azorhizobium caulinodans: AZC_2137Help
Entry
AZC_2137          CDS       T00609                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AZC_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2455359..2456120
Genome map
AA seq 253 aa AA seqDB search
MSAQTISRDGVDLVKAFESCLKPAPGRKGFFTTYLCPAGVLTIGWGHTNDHGRAFRAGAV
WSQAECDTALAQDLATLEASVSTILKDVPLAQHEYDALVSMSYNIGPLTRSSIPAKLKAG
RKAEVRAVMARWNKGGGRVLPGLTRRREAEADLFEGKIDEALRTAGVMRAAALPMPQKVD
VPKPPVSVVAAGTKRETAGMAAGGTLAAGSGSGEAHPFSSALTAAGLALGLALVVAAGFL
LVRKYKLIAEDWR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagcccagaccatttcgcgcgacggggtggacctcgtcaaagcctttgaaagctgc
ctgaaaccggcccccggccgcaagggcttcttcaccacctatctctgcccggcgggcgtc
ctcaccatcggctggggccacaccaacgatcacgggcgggcgttcagggcgggcgccgtc
tggagccaggccgagtgcgacaccgcgctcgcccaggacctcgccaccctcgaggccagc
gtctccaccatcctgaaggacgtgccgctcgcccagcacgagtatgatgcgctggtctcg
atgtcctacaacatcggcccgctcacccgctcgtccatccccgccaaattgaaggccggc
cggaaggccgaggtccgcgccgtcatggcccgctggaacaagggcggcggccgggtgctg
ccgggcctcacccgtcgccgggaggcggaggccgatctcttcgagggcaagatcgacgag
gccctgcgcacggccggcgtcatgcgcgccgccgcgctccccatgccgcagaaggtcgat
gtgccgaagcccccggtctcggtggtggccgccggcacgaagcgcgagaccgccgggatg
gcggccggcggcacgctcgccgcgggctccggctcgggcgaggcccatcctttctcttcc
gctctcaccgccgcgggcctcgccctcggcctcgccctggtcgtcgcggccggcttcctg
ctggtccgcaagtacaagctcatcgcagaggattggcgctga

DBGET integrated database retrieval system