KEGG   Azorhizobium caulinodans: AZC_2205Help
Entry
AZC_2205          CDS       T00609                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
azc01230  Biosynthesis of amino acids
Module
azc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZC_2205
Enzymes [BR:azc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AZC_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAF88203
RhizoBase: AZC_2205
UniProt: A8I836
Position
complement(2519438..2520229)
Genome map
AA seq 263 aa AA seqDB search
MSDILSRIETYKRAEIEAARAARPQAETEAAARAADPVRPFAKALEAKIAAGQTALIAEI
KKASPSKGLIRPDFDPPVLARAYEDGGAACLSILTDGPSFQGAPEYLIAARAQVSLPVLR
KDFLFDTYQVAEARAWGADCILVIMAAVDDALARDLVEAATDFGMDSIIEVHDEAELDRA
LALPSKLIGINNRNLRTFETTLATSGRLAPRVPKDRIVIGESGIFTHADVKLLRQVGIAS
ILVGESLMRQEDVTSATRTLLNG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctttcccgcatcgagacctacaagcgcgccgagatcgaagccgcccgc
gccgcgcgtccgcaggccgagaccgaggcggccgcccgcgccgctgatcccgtgcgcccc
ttcgccaaggcgctggaggcgaagatcgccgccggccagacggctctgatcgccgagatc
aagaaggcaagcccttccaagggcctcatccgtccggatttcgatccgccggtgctggcc
cgcgcctatgaggacgggggcgcggcctgcctctccatcctgaccgacggcccttctttc
cagggcgcgccggaatatctcatcgccgcccgcgcgcaggtaagcctgccggtgctgcgc
aaggacttcctgttcgacacctatcaggtggcggaagcccgcgcgtggggcgccgactgc
atcctcgtcatcatggccgccgtggatgacgcgctcgcccgcgaccttgtggaggcggcg
accgatttcggcatggattcgatcatcgaggtgcatgacgaagccgagctcgaccgggcg
ctggctctgccctcaaagctcatcggcattaacaaccgcaacctgcgcaccttcgagacg
acgctcgccacctccggccgcctcgccccgcgcgtgccgaaggaccgcatcgtcatcggc
gagagcggcatcttcacgcatgcggacgtgaagctgctccggcaggtgggcatcgccagc
attctcgtgggcgaaagcctgatgcggcaggaggatgtcacctccgccacccgcacgctg
ctgaacggctga

DBGET integrated database retrieval system