KEGG   Azorhizobium caulinodans: AZC_2210Help
Entry
AZC_2210          CDS       T00609                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_2210
   01230 Biosynthesis of amino acids
    AZC_2210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_2210
   00051 Fructose and mannose metabolism
    AZC_2210
   00562 Inositol phosphate metabolism
    AZC_2210
Enzymes [BR:azc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AZC_2210
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AZC_2210
  Exosomal proteins of bladder cancer cells
   AZC_2210
  Exosomal proteins of melanoma cells
   AZC_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2525601..2526362
Genome map
AA seq 253 aa AA seqDB search
MMMSAERRPLVAGNWKMNGLKASTAEIGAIAAGYNAALAGKIDLLLCPPATVLAQAATLA
DGRILVGGQDCHAKASGAHTGDISAEMLADAGAKAVIVGHSERRADHHESDADVRAKAEA
AWRAGLVAVICVGESEAQRRAGEHGAVVAAQVRGSVPDGATSSNTVVAYEPIWAIGTGLV
PTPADVAEVHGIVRSVLAERFGAAAGGMRILYGGSVKPENAKALLGAADVDGALVGGASL
KAADFLAIARTYL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtccgccgaacgccgccccctcgttgccggaaattggaagatgaacgggctg
aaggcgtccacggcggaaatcggcgcgatcgcggccggttataatgcggcccttgcgggc
aagatcgatctgctcctgtgcccgcccgccaccgtgctggcgcaggccgcgaccctcgcg
gacggccgtatccttgtgggcggtcaggactgccacgccaaggcgagcggcgcccatacc
ggcgacatctccgccgagatgctggcggatgccggcgccaaggcggtgatcgtcggccat
tccgagcgccgggccgaccaccacgagagcgatgccgatgtccgggccaaggcggaagcc
gcttggcgcgccgggctcgtggccgtcatctgcgtcggcgagagcgaggctcagcgtcgg
gcgggcgagcacggcgcggtcgtggcggctcaggtgcgcggctcggtgccggatggcgcg
acgtcgtccaatacggttgtcgcctacgagcccatctgggccatcggcaccggcctcgtg
ccgacgccggccgatgtggcggaagtccacggcattgtccgctccgtgctggccgagcgc
ttcggcgcggcggcgggcggcatgcgcatcctctatggcggctccgtgaagcctgagaac
gccaaggctctgctgggcgcggccgatgtggacggcgccctcgtcggcggcgccagcctc
aaggcggcggactttctcgccatcgcgcgcacctatctctga

DBGET integrated database retrieval system