KEGG   Azorhizobium caulinodans: AZC_2305Help
Entry
AZC_2305          CDS       T00609                                 

Definition
(GenBank) putative cytochrome c protein
  KO
K08738  cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAF88303
RhizoBase: AZC_2305
UniProt: A8I5P2
Position
complement(2630072..2630467)
Genome map
AA seq 131 aa AA seqDB search
MTRILLAVLALAASTALASADADVAKGEQAFKKCMACHAVGPEAKTKVGPPLNGIVGAKW
AHFEGYAYSEDIKAGAAAGKVWDEATLNDYLTNPKVLAPKGKMAFIGIKNEAERADLIAY
LAQFNADGSKK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtattctgcttgctgttctggcccttgcggcctccacggcgctggcgtccgcc
gatgcggacgtggccaagggcgaacaggcgttcaagaagtgcatggcctgccatgccgtc
ggccccgaagccaagaccaaggtcggcccgcctctgaacggcatcgtcggcgccaagtgg
gcccatttcgagggctatgcctattccgaggacatcaaggctggcgctgccgcgggcaag
gtgtgggacgaggcgaccctcaacgactacctgaccaatcccaaggttctcgctcccaag
ggcaagatggcgttcatcggcatcaagaacgaagccgagcgcgccgacctcatcgcctat
ctggcgcagttcaacgccgacgggtcgaagaagtga

DBGET integrated database retrieval system