KEGG   Azorhizobium caulinodans: AZC_2467Help
Entry
AZC_2467          CDS       T00609                                 

Definition
guanosine monophosphate kinase like protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
azc  Azorhizobium caulinodans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AZC_2467
Enzymes [BR:azc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AZC_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2802843..2804924)
Genome map
AA seq 693 aa AA seqDB search
MSVMGSGLFFFVVGPSGSGKDTLIEGAKAALGPTGRYVFARRAITRPADAGGEAHEALSV
DQFDAVLAQGGFLIHWEAHGLKYGLRATLLDDMAAGRHVIANGSRAMVAALAERVPHLVV
VEITAPEAVLAERLKGRGREGAENIAARLERKVPPFPESVTVIQVPNDSTPRAGIEKFVA
ALVAQTARLRLVRMAIETGRRNVAFLARGNTVVAAPDYLGPGRVDLIGEGRSIRAEVALV
GDALLPSDAVGLSSEAFGALGLPEGAELVLTRTPVPESRAALRRKIQGATLDEGAYAQVV
GDIVEGRYPDSEVAGFLVAADRSLSDDEVLALAKVRAKFASRITWDEPMVVDKHSMGGIP
GSRITMIVVPIVAAHGLAIPKTSSRAITSAAGTADAMETLARVDLDSAEVRRTVERARGC
IAWNGRLSHSALDDVMNAITRPLGLDSTRWSVASILSKKLAAGSTHVVIDLPFGARARVK
GAGEAHEMARLFEQVGAGLGLTVEAIPTDGSAPIGRGIGPALEVRDVLWVLEDHSEAPPD
LKEKALFFASRILAWDPAVGPDRARARAEELLASGAARAALERIVEAQGRWSEPVRPARL
THTVTAQNDGQVSDIDGFAVAGIARLAGAPLDKGAGIDLKARVGDVVRAGDPLFVIHAST
AADLEAAAGAALAFDGYGIMMDGKAFRRINPER
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcatgggatcgggactcttcttcttcgtggtcgggccgagcggctcgggcaag
gacaccctcatcgagggggcgaaggcggctctcggtcccaccggacgttacgtgtttgcg
cgccgggccatcacccggccggccgatgcgggcggcgaggcgcacgaggcgctgagcgtt
gaccagtttgacgccgtgctggcgcagggcggattcctgatccattgggaggcccatggg
ctcaaatacggcctgcgcgccacactgctcgacgacatggccgccgggcgtcacgtgatc
gccaacggctcgcgagccatggtcgcggcgctggcggagcgggtgccgcatctcgtggtg
gtggagatcaccgcaccggaggcggtgctggccgagcggctgaagggcaggggacgcgag
ggcgcggagaacatcgccgcccggcttgagcgcaaagtgccgccgtttccggagagcgtc
acggtcattcaggtgccgaacgacagcacgccgcgcgccggcatcgagaaattcgtcgct
gcgcttgtcgcgcagaccgcccgcctgaggctggtgcggatggccattgagaccggacgc
cgcaacgtcgcctttctggctcgtgggaataccgttgtggccgcaccggactatctcggg
ccgggacgtgtggacctgatcggggaggggcgcagtatccgcgccgaagtggccctggtg
ggcgatgccttgctgccgtccgatgccgtcggcctgtcgtcggaagccttcggggctctc
ggcctgcccgaaggcgcggaactggtcctcacccgcacccccgtgcccgaaagccgcgcc
gcgctccgccgtaagatccagggcgcgacgctggatgagggcgcttatgcgcaggtcgtc
ggagacatcgtggaggggcgttatcccgacagcgaggtcgccggctttctcgtagccgcc
gaccgcagcctgagtgacgacgaagtgctggcgctcgccaaggtgcgggcgaaattcgcg
agccgcatcacatgggacgagcccatggtggtggacaagcattccatgggcggcattccc
ggttcccgcatcaccatgatcgtggtgccgatcgtcgccgcgcacgggctcgccatcccc
aagacctcctcccgcgccatcacctcggcggccggcacggcggacgccatggagacgctg
gcgcgcgtcgatctcgacagcgccgaggtgcgccggacggtggaacgggcacgcggctgc
atcgcctggaacgggcggctcagtcattcggccctcgatgatgtcatgaacgccattacg
cggccgctggggctcgattccacccgctggtcggtggcctccatcctgtccaagaagctg
gcggctggctcgacccatgtggtgatcgacctgccgtttggcgcccgcgcccgcgtgaag
ggggcgggcgaagcccacgagatggcgcgcctgttcgagcaggtcggcgccgggctcggc
ctcaccgtcgaagccattcccaccgacggcagcgctcccatcgggcgcggcatcgggccg
gctcttgaggtccgggacgtgctctgggtcctggaggatcattccgaagccccgccggac
ctgaaagagaaggccctcttcttcgccagccgcattctcgcctgggatccggccgttggt
ccggacagggcgcgcgcccgcgccgaggagcttctcgcttccggtgccgcccgcgcggcg
ctggagcggatcgtggaggcgcaagggcgctggagcgagccggtgcgtcccgcccgcctc
acgcacaccgtgaccgcccaaaatgacggacaggtgagcgatatcgacgggttcgccgtg
gccggcatcgctcgccttgccggcgcgccgctggacaagggtgccggtatcgatctgaag
gcgcgggtgggcgacgtggtgcgcgcgggagacccgctctttgtcatccatgcctccacg
gctgccgatctcgaggcggccgcgggcgccgcgctcgcgttcgacggctacggcatcatg
atggacgggaaagcattccgcaggatcaatccggagcggtag

DBGET integrated database retrieval system