KEGG   Azorhizobium caulinodans: AZC_2710Help
Entry
AZC_2710          CDS       T00609                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AZC_2710
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AZC_2710
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZC_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3076038..3077534
Genome map
AA seq 498 aa AA seqDB search
MTKYVGAIDQGTTSTRFIVFDRKGQIFSVAQREHEQIYPRPGWVEHNAVEIWLNTRTVIL
EALEKKGLSTSDLAAVGVTNQRETALLWDRKTGEPLYNALVWQDTRTDQLVARYAKEGGQ
DRLRAKTGLPLATYFSGLKLHWILDNVPGARAKAEAGDALFGNIDTWLLWNLTGGPDGGI
HITDVTNASRTQLMDLEKLAWDEDILKLFNIPAACLPRIVSSSERYGTGKGPLEGVTLSG
ILGDQQAALFGQACLHPGEAKNTYGTGNFMLMNTGEKPFPSTCGLITTVGYKLGDAKAVY
ALEGSIAITGALVQWLRDNLGIIKNSADIEPLARTVSDNGDVYFVPAFSGLYAPRWDDSA
RGVVCGLTRFANKGHIARAALEATAYQTREVLEAMVKDSKVAIRELRTDGGMVVNELLMQ
FQADMVNVPVVRPKVIETTALGAAYAAGLAVGYWASTDDITQNWGVDRRWHPHMAAEQRE
HLYGSWNKAVERSLGWAR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacgtgggcgccatcgatcagggcacgacgagcacgcgcttcatcgtgttc
gaccgcaagggccagatcttcagcgtggcccagcgcgagcatgagcagatctatccccgg
ccgggctgggtggagcacaatgcggtcgagatctggctcaacacccgcacggtgatcctg
gaggccctcgagaagaagggtctctccacgtccgacctcgccgccgtcggcgtgaccaac
cagcgcgaaaccgcgctcctgtgggaccgcaaaaccggcgaaccgctctacaacgccctc
gtctggcaggacacccgcaccgaccagctcgtcgcccgctacgcgaaggagggtggccag
gaccgactgcgtgccaagaccggcctgccgctcgccacctatttctccggcctgaagctg
cactggatcctcgacaacgtgcccggcgcccgcgccaaggccgaggccggcgacgcgctg
ttcggcaatatcgatacctggctgctctggaacctcaccggcggtccggacggcggcatc
cacatcaccgacgtcaccaacgcctcgcgcacccagctcatggacctcgagaagctggcg
tgggacgaggacatcctgaagctgttcaacatcccggctgcctgcctgccgcgcatcgtc
tcctcctcggagcgctacggcaccggcaaggggccgctggaaggcgtgacgctctccggc
atcctcggcgaccagcaggcggccctgttcggccaggcctgcctgcatccgggcgaagcc
aagaacacctacggcaccggcaacttcatgctgatgaacaccggtgagaagcccttcccc
tccacctgcggtctcatcacgacggtgggctacaagctgggcgatgcgaaagcggtctat
gcgctggaaggttccatcgccatcaccggcgctctggtgcagtggctgcgcgacaacctc
ggcatcatcaagaactcggccgacatcgagccgctcgcccgcacggtcagcgataacggc
gacgtctatttcgtccccgccttctccggcctttatgcgccgcggtgggatgacagcgcg
cgcggcgtcgtctgcggtctcacccgcttcgccaacaagggccacatcgcccgcgccgcg
ctggaggcgaccgcctaccagacgcgcgaggtgctggaagccatggtgaaggattccaag
gtcgccattcgcgagctgcgcaccgacggcggcatggtggtcaatgaactgctcatgcag
ttccaggccgatatggtgaacgtgccggtcgtccgccccaaggtcatcgagaccacggcg
ctgggcgccgcttatgcggcgggccttgccgtcggctactgggcgtccaccgacgacatc
acccagaactggggtgtcgaccggcgctggcacccgcacatggctgcggagcagcgcgaa
cacctgtatggctcgtggaacaaggccgttgagcgctccctcggttgggcgcgctga

DBGET integrated database retrieval system