KEGG   Azorhizobium caulinodans: AZC_2710Help
Entry
AZC_2710          CDS       T00609                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:azc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3076038..3077534
Genome map
AA seq 498 aa AA seqDB search
MTKYVGAIDQGTTSTRFIVFDRKGQIFSVAQREHEQIYPRPGWVEHNAVEIWLNTRTVIL
EALEKKGLSTSDLAAVGVTNQRETALLWDRKTGEPLYNALVWQDTRTDQLVARYAKEGGQ
DRLRAKTGLPLATYFSGLKLHWILDNVPGARAKAEAGDALFGNIDTWLLWNLTGGPDGGI
HITDVTNASRTQLMDLEKLAWDEDILKLFNIPAACLPRIVSSSERYGTGKGPLEGVTLSG
ILGDQQAALFGQACLHPGEAKNTYGTGNFMLMNTGEKPFPSTCGLITTVGYKLGDAKAVY
ALEGSIAITGALVQWLRDNLGIIKNSADIEPLARTVSDNGDVYFVPAFSGLYAPRWDDSA
RGVVCGLTRFANKGHIARAALEATAYQTREVLEAMVKDSKVAIRELRTDGGMVVNELLMQ
FQADMVNVPVVRPKVIETTALGAAYAAGLAVGYWASTDDITQNWGVDRRWHPHMAAEQRE
HLYGSWNKAVERSLGWAR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacgtgggcgccatcgatcagggcacgacgagcacgcgcttcatcgtgttc
gaccgcaagggccagatcttcagcgtggcccagcgcgagcatgagcagatctatccccgg
ccgggctgggtggagcacaatgcggtcgagatctggctcaacacccgcacggtgatcctg
gaggccctcgagaagaagggtctctccacgtccgacctcgccgccgtcggcgtgaccaac
cagcgcgaaaccgcgctcctgtgggaccgcaaaaccggcgaaccgctctacaacgccctc
gtctggcaggacacccgcaccgaccagctcgtcgcccgctacgcgaaggagggtggccag
gaccgactgcgtgccaagaccggcctgccgctcgccacctatttctccggcctgaagctg
cactggatcctcgacaacgtgcccggcgcccgcgccaaggccgaggccggcgacgcgctg
ttcggcaatatcgatacctggctgctctggaacctcaccggcggtccggacggcggcatc
cacatcaccgacgtcaccaacgcctcgcgcacccagctcatggacctcgagaagctggcg
tgggacgaggacatcctgaagctgttcaacatcccggctgcctgcctgccgcgcatcgtc
tcctcctcggagcgctacggcaccggcaaggggccgctggaaggcgtgacgctctccggc
atcctcggcgaccagcaggcggccctgttcggccaggcctgcctgcatccgggcgaagcc
aagaacacctacggcaccggcaacttcatgctgatgaacaccggtgagaagcccttcccc
tccacctgcggtctcatcacgacggtgggctacaagctgggcgatgcgaaagcggtctat
gcgctggaaggttccatcgccatcaccggcgctctggtgcagtggctgcgcgacaacctc
ggcatcatcaagaactcggccgacatcgagccgctcgcccgcacggtcagcgataacggc
gacgtctatttcgtccccgccttctccggcctttatgcgccgcggtgggatgacagcgcg
cgcggcgtcgtctgcggtctcacccgcttcgccaacaagggccacatcgcccgcgccgcg
ctggaggcgaccgcctaccagacgcgcgaggtgctggaagccatggtgaaggattccaag
gtcgccattcgcgagctgcgcaccgacggcggcatggtggtcaatgaactgctcatgcag
ttccaggccgatatggtgaacgtgccggtcgtccgccccaaggtcatcgagaccacggcg
ctgggcgccgcttatgcggcgggccttgccgtcggctactgggcgtccaccgacgacatc
acccagaactggggtgtcgaccggcgctggcacccgcacatggctgcggagcagcgcgaa
cacctgtatggctcgtggaacaaggccgttgagcgctccctcggttgggcgcgctga

DBGET integrated database retrieval system