KEGG   Azorhizobium caulinodans: AZC_2806Help
Entry
AZC_2806          CDS       T00609                                 

Gene name
argS
Definition
arginyl-tRNA synthetase
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
azc  Azorhizobium caulinodans
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:azc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZC_2806 (argS)
Enzymes [BR:azc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     AZC_2806 (argS)
Amino acid related enzymes [BR:azc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AZC_2806 (argS)
Transfer RNA biogenesis [BR:azc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AZC_2806 (argS)
 Prokaryotic Type
   Other AARSs
    AZC_2806 (argS)
Mitochondrial biogenesis [BR:azc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AZC_2806 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3190847..3192607)
Genome map
AA seq 586 aa AA seqDB search
MNVYAIFADHVREAVAALAGELPEAGALDLSRIVVEPPRDAAHGDLATNAAMVLAKDLKM
KPRDLAEKIAARLAQVPNVAKVDVAGPGFINLTLDAGYWPGVLAALLRAGTDFGRSDLGG
GEAVNVEYVSANPTGPMHVGHCRGAVFGDALASLLAFAGFKVTREYYINDAGAQVDVLAR
SAYLRYREAATGETVEIPDGLYPGDYLVPVGKTLAEVHGSEYLESPESEWLPIFRTFAIG
AMMEMIRDDLQALGISFDVFFSERSLTAAGIDRVGLTIEQLRRTGEVYEGRLPPPKGAPI
EDWEDREQSLFRSTAHGDDVDRPLVKSDGSYTYFAGDIAYHKDKFDRGFRRMIDVWGADH
GGYVKRMQAAVKAVTAGQATLDVELCQLVRLLRNGEQVRMSKRAGSFVTLREVVDEVGRD
AVRFMMLFRKNDATLDFDLAKVIEQSRENPVFYVQYAHARAQSILRNAKEQHADLPESGA
IYAHAPLDRLTDEGELGLVKRLAGWPRLVEQAAHAREPHRVAFYLHEVASEFHGQWNRGK
DLPHLRFIIENDRELTMARLALVHGVAAVLASGLGLLGVEAVDEMK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctacgcgatcttcgccgatcacgtgagagaagccgtcgccgctcttgccggc
gaactgcccgaggccggcgcgctcgacctctcccggatcgtcgtcgagcccccgcgtgac
gccgcccatggcgatctcgccaccaatgcggccatggtcctcgccaaggacctgaagatg
aagccgcgcgatctcgccgagaagatcgccgcgcggctcgcgcaggtgccgaacgtggcc
aaggtggacgtggccggacccggcttcatcaacctcaccctcgacgccggttactggccc
ggcgtgctcgccgcgctgctgcgcgcgggcaccgacttcggccgctcggacctcgggggc
ggggaggcggtgaacgtggaatacgtctccgccaaccccaccggccccatgcatgtgggc
cattgccggggcgcggtgttcggcgatgcgctggcgagcctcctggctttcgccggtttc
aaggtgacccgcgaatattacatcaacgacgcgggcgcccaggtggacgtgctcgctcgc
tccgcctacctgcgctatcgcgaggcggccaccggcgagacggtcgagatccccgacggg
ctctatccgggcgattacctcgtgcccgtgggcaagacgctcgccgaggtgcacggctcg
gaatatctggaatcgcccgagagcgagtggctgccgattttccgcaccttcgccatcggc
gcgatgatggagatgatccgcgacgatctccaggcgctcggcatctccttcgacgtcttc
ttctccgagcgctcgctgaccgccgccggcatcgaccgggtgggcctcaccatcgagcaa
ctgcgtcgcaccggggaggtttatgagggccgtctgccgccgcccaagggcgcgcccatc
gaggactgggaggatcgcgagcagagcctgttccgctccaccgcccatggtgacgatgtg
gaccgcccgctggtgaagtccgacggcagctacacctatttcgccggcgacatcgcctat
cacaaggacaagttcgaccgcggcttccgccgcatgatcgatgtctggggcgccgaccat
ggcggctatgtgaagcgcatgcaggccgccgtgaaggcggtcaccgccggtcaggcgacc
ctcgatgtggaactgtgtcagctcgtgcgcctgctgcgcaacggcgagcaggtgcgcatg
tcgaagcgcgcgggctccttcgtcacgctccgcgaggtggtggacgaggtggggcgcgat
gcggtccgcttcatgatgctgttccgcaagaatgacgcgacgctcgatttcgatctcgcg
aaggtgatcgagcagtcccgcgagaaccccgtattctatgtgcagtatgcgcatgcgcgg
gcgcagtcgatcctgcgcaacgcgaaggaacagcatgccgatctgccggaaagcggcgcc
atttatgcgcacgcgccgctggaccggttgacggacgagggcgaacttggtctggtgaag
cggctggcgggctggccgcgccttgtggagcaggcggctcacgcccgcgaaccgcaccgc
gtggccttctatctgcatgaggtggcgagcgagttccacggacagtggaaccgcggaaaa
gacttgccacatttacgcttcattatcgagaatgatcgagaattgaccatggcccgtctg
gctttggtccacggcgtggctgcggtcctcgcctctggccttggcttgctgggtgtcgag
gccgtcgacgaaatgaagtga

DBGET integrated database retrieval system