KEGG   Azorhizobium caulinodans: AZC_2806Help
Entry
AZC_2806          CDS       T00609                                 

Gene name
argS
Definition
arginyl-tRNA synthetase
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
azc  Azorhizobium caulinodans
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:azc00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3190847..3192607)
Genome map
AA seq 586 aa AA seqDB search
MNVYAIFADHVREAVAALAGELPEAGALDLSRIVVEPPRDAAHGDLATNAAMVLAKDLKM
KPRDLAEKIAARLAQVPNVAKVDVAGPGFINLTLDAGYWPGVLAALLRAGTDFGRSDLGG
GEAVNVEYVSANPTGPMHVGHCRGAVFGDALASLLAFAGFKVTREYYINDAGAQVDVLAR
SAYLRYREAATGETVEIPDGLYPGDYLVPVGKTLAEVHGSEYLESPESEWLPIFRTFAIG
AMMEMIRDDLQALGISFDVFFSERSLTAAGIDRVGLTIEQLRRTGEVYEGRLPPPKGAPI
EDWEDREQSLFRSTAHGDDVDRPLVKSDGSYTYFAGDIAYHKDKFDRGFRRMIDVWGADH
GGYVKRMQAAVKAVTAGQATLDVELCQLVRLLRNGEQVRMSKRAGSFVTLREVVDEVGRD
AVRFMMLFRKNDATLDFDLAKVIEQSRENPVFYVQYAHARAQSILRNAKEQHADLPESGA
IYAHAPLDRLTDEGELGLVKRLAGWPRLVEQAAHAREPHRVAFYLHEVASEFHGQWNRGK
DLPHLRFIIENDRELTMARLALVHGVAAVLASGLGLLGVEAVDEMK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctacgcgatcttcgccgatcacgtgagagaagccgtcgccgctcttgccggc
gaactgcccgaggccggcgcgctcgacctctcccggatcgtcgtcgagcccccgcgtgac
gccgcccatggcgatctcgccaccaatgcggccatggtcctcgccaaggacctgaagatg
aagccgcgcgatctcgccgagaagatcgccgcgcggctcgcgcaggtgccgaacgtggcc
aaggtggacgtggccggacccggcttcatcaacctcaccctcgacgccggttactggccc
ggcgtgctcgccgcgctgctgcgcgcgggcaccgacttcggccgctcggacctcgggggc
ggggaggcggtgaacgtggaatacgtctccgccaaccccaccggccccatgcatgtgggc
cattgccggggcgcggtgttcggcgatgcgctggcgagcctcctggctttcgccggtttc
aaggtgacccgcgaatattacatcaacgacgcgggcgcccaggtggacgtgctcgctcgc
tccgcctacctgcgctatcgcgaggcggccaccggcgagacggtcgagatccccgacggg
ctctatccgggcgattacctcgtgcccgtgggcaagacgctcgccgaggtgcacggctcg
gaatatctggaatcgcccgagagcgagtggctgccgattttccgcaccttcgccatcggc
gcgatgatggagatgatccgcgacgatctccaggcgctcggcatctccttcgacgtcttc
ttctccgagcgctcgctgaccgccgccggcatcgaccgggtgggcctcaccatcgagcaa
ctgcgtcgcaccggggaggtttatgagggccgtctgccgccgcccaagggcgcgcccatc
gaggactgggaggatcgcgagcagagcctgttccgctccaccgcccatggtgacgatgtg
gaccgcccgctggtgaagtccgacggcagctacacctatttcgccggcgacatcgcctat
cacaaggacaagttcgaccgcggcttccgccgcatgatcgatgtctggggcgccgaccat
ggcggctatgtgaagcgcatgcaggccgccgtgaaggcggtcaccgccggtcaggcgacc
ctcgatgtggaactgtgtcagctcgtgcgcctgctgcgcaacggcgagcaggtgcgcatg
tcgaagcgcgcgggctccttcgtcacgctccgcgaggtggtggacgaggtggggcgcgat
gcggtccgcttcatgatgctgttccgcaagaatgacgcgacgctcgatttcgatctcgcg
aaggtgatcgagcagtcccgcgagaaccccgtattctatgtgcagtatgcgcatgcgcgg
gcgcagtcgatcctgcgcaacgcgaaggaacagcatgccgatctgccggaaagcggcgcc
atttatgcgcacgcgccgctggaccggttgacggacgagggcgaacttggtctggtgaag
cggctggcgggctggccgcgccttgtggagcaggcggctcacgcccgcgaaccgcaccgc
gtggccttctatctgcatgaggtggcgagcgagttccacggacagtggaaccgcggaaaa
gacttgccacatttacgcttcattatcgagaatgatcgagaattgaccatggcccgtctg
gctttggtccacggcgtggctgcggtcctcgcctctggccttggcttgctgggtgtcgag
gccgtcgacgaaatgaagtga

DBGET integrated database retrieval system