KEGG   Azorhizobium caulinodans: AZC_2818Help
Entry
AZC_2818          CDS       T00609                                 

Definition
methyltransferase transmembrane protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AZC_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3206513..3207184)
Genome map
AA seq 223 aa AA seqDB search
MVDYAELRRGMVDSQVRANDVTDLRIVAAMMEMPRERFVPANLKSLAYIDEDLVIRAATA
QQPARYLIEPMVLAKLIQLADVQADEIVLDVAAGTGYSAAVLARLSQQVVALEDDADLVA
AANAVLSELAITNVAVLKGPLTAGWAAEGPYDVILLNGAVDVVPQALFDQLKDGGRLVAV
VGRGGAAHAVIYTKVGGAVSERVVFNASVPTLPGFEAPQRFTF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcgattacgcggaactgcgccgggggatggtcgattcccaggtgcgcgccaatgac
gtgacggatctgcgcatcgtggccgccatgatggagatgccgcgcgagcgcttcgttccc
gccaacctcaagtcgctggcctatatcgacgaggatctggtgatccgcgccgcgaccgcc
cagcagccggcccgctatctgatcgagccgatggtgctcgccaagctgattcagctcgcc
gacgtgcaggccgacgagatcgtgctcgatgtggccgccggcaccggctattcggccgcc
gtcctcgcccgcctctcgcagcaggtggtggcgctggaggatgatgccgacctcgtcgcc
gccgccaacgccgtgctgagcgaactggccatcaccaacgtcgccgtcctcaagggaccg
ctcaccgccggctgggcagccgaggggccttacgacgtgattcttctcaacggcgccgtg
gatgtggtgccgcaggccctgttcgaccagctcaaggacggcggtcgcctcgtggcggtg
gtcggccggggcggtgcggcccatgcggtgatctacaccaaggtgggcggtgcggtgtcc
gagcgggtggtgttcaacgcctccgtgcccacgctgccgggcttcgaggcgccgcagcgc
ttcactttctag

DBGET integrated database retrieval system