KEGG   Azorhizobium caulinodans: AZC_2851Help
Entry
AZC_2851          CDS       T00609                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
azc  Azorhizobium caulinodans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:azc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:azc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3245287..3246252)
Genome map
AA seq 321 aa AA seqDB search
MITAPFFTLDRRDLLGIEGLSAPEIVGLLDLAEEFVVLNRQIEKKRSTLRGRTQVNLFFE
ASTRTQSSFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMRPDILVVRHHASGA
VALLARKVDCCVVNAGDGAHEHPTQALLDALTIRRNKGRIEGLTVAVCGDVLHSRVARSN
ILLLHTLGARVRVVAPSTLLPTGIENFGVEVHRSMESGLEGADIVMMLRLQRERMAGSFI
PSVKEYFHYYGLDEAKLKRAKPDALVMHPGPMNRGVEIDSAVADGAQSLIREQVEMGVAV
RMAVLDALARKLPNATGAERD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagccccattcttcaccctcgatcgccgcgacctcctcggcatcgaaggcctt
tccgcgccggaaatcgtcggcctcctagacctggctgaggaattcgtcgtcctcaaccgg
cagatcgagaaaaagcgttcgaccttgcggggccgcacgcaggtgaacctgttcttcgag
gcctccacccgcacccagtcctccttcgagctggcgggcaagcgcctcggggccgacgtg
atgaacatgtcggtgggcaattcctcggtgaagaagggcgagacgctcatcgacaccgcc
atgacgctgaacgccatgcgccccgacatcctggtggtgcgccatcatgcgtcgggcgcc
gtggcgctgctcgcccgcaaggtggactgctgcgtggtgaatgccggcgacggcgcccat
gagcatcccacccaggcgctgctcgacgccctcaccatccgccgcaacaaggggcggatc
gaggggctgacggtggcggtgtgcggcgatgtcctgcattcgcgcgtcgcccgctccaac
atcctgctcctgcacacgctcggcgcgcgggtgcgggtggtggcgccgtctacgctgctg
cccaccggcatcgagaatttcggcgtcgaggtgcaccgctccatggagagcggtctcgaa
ggggcggacatcgtgatgatgttgcggctccagcgcgagcgcatggccggctccttcatc
ccctcggtgaaggaatatttccattattacggcctcgacgaagccaagctgaaacgggcc
aagcccgatgcgctggtgatgcatcccggccccatgaaccggggcgtcgagatcgattcg
gcggtggcggacggtgcgcagtcgctgatccgcgagcaggtggaaatgggcgtcgccgtg
cgcatggcggtgctggacgctctggcgcgcaagctgcccaacgcgacgggagccgaacgt
gactga

DBGET integrated database retrieval system