KEGG   Azorhizobium caulinodans: AZC_3151Help
Entry
AZC_3151          CDS       T00609                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
azc  Azorhizobium caulinodans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:azc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:azc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3604740..3606029)
Genome map
AA seq 429 aa AA seqDB search
MDKIRIIGGGSLNGTIPISGAKNAALPLMIAALLSEEKLVLENVPRLADVALLQRILGNH
GVDITVNGKRNGDDPHAGQTMEIDARVIVDTTAPYDLVSRMRASFWVVGPLLARMGEARV
SLPGGCAIGTRPVDFHLDALRALGADIDIDAGYVVARAPHGLTGARIVFPKVSVGATHTA
IMAAALAKGDTVIENAAREPEIVDLADCLIKMGARIEGAGTSTIEISGVPRLRGARHSVL
PDRIETGTYAMATAMTGGDVTLAGARADLLESALDVLRKAGAQIDVNNEGIRVRRNGAGI
FPVEVSTAPHPGFPTDLQAQLMALMTRAQGRSRITETIFENRFMHVQELARLGANIHLEG
DTAIVEGSDRLKGAPVMATDLRASVSLVIAGLAAEGETMIQRVYHLDRGFERLEEKLSRC
GAQIERISG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaagattcgcatcatcggcggcggcagcctcaacggcaccattccgatctccggt
gccaagaatgccgccctgccgctgatgatcgcggcgctgctctcggaagagaagctggtg
ctggagaatgtgccgcggctcgcggacgtggcgctgctccagcgcattctcggcaaccac
ggcgtggacatcacggtcaacggcaagcgcaacggggacgatccccacgccggccagacg
atggagatcgacgcccgcgtgatcgtcgataccaccgcgccctatgatctcgtgtcccgg
atgcgggccagcttctgggtggtcgggccgctgctggcgcgcatgggcgaggcccgcgtc
tcgcttcccggcggctgcgccatcggcacccggcccgtggacttccatctcgatgccctg
cgggcgctgggcgccgatatcgacatcgatgccggctatgtggtcgcccgcgcgccgcac
ggcctcaccggtgcccgcatcgtgttcccgaaggtgtcggtgggcgcgacccacaccgcc
atcatggcggcggccctcgccaagggcgatacggtgatcgagaacgccgcccgcgagccc
gagatcgtcgatctcgccgactgcctcatcaagatgggcgcacggatcgagggcgcgggc
acgtccaccatcgagatttccggtgtgccgcgcctgcgcggcgcgcgccattcggtcctg
cccgaccgcatcgagacgggcacctatgccatggccacggccatgaccggcggcgatgtg
acgctcgccggcgcgcgggcggacctgctcgagagtgcgctcgatgtgctgcgcaaggcg
ggcgcgcagatcgacgtgaacaacgagggcatccgcgtccgccgcaacggcgcgggcatc
ttccccgtggaggtctccacggcgccgcatccgggcttcccgaccgaccttcaggcccag
ctcatggccctgatgacgcgggcccagggccgctcgcgcatcaccgagaccatcttcgag
aaccgcttcatgcatgtgcaggaactggcccgtctcggcgccaatatccatctggagggc
gacaccgccatcgtggagggctccgaccgcctcaagggcgccccggtgatggcgaccgac
ctgcgtgcctccgtgtccctcgtcatcgccggccttgccgccgagggcgagaccatgatc
cagcgcgtctatcacctcgaccgcggcttcgagcggctggaggagaagctctcccgctgc
ggcgcgcagatcgagcgcatcagcggctga

DBGET integrated database retrieval system