KEGG   Azorhizobium caulinodans: AZC_3211Help
Entry
AZC_3211          CDS       T00609                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
azc  Azorhizobium caulinodans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:azc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:azc00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3675748..3676527)
Genome map
AA seq 259 aa AA seqDB search
MKGRNAVVTGSTSGIGLAIARSLAAEGCNVMLNGFGEPAQIEMVRREMAETTGCTIGYSG
ADMGRPEEVRALIAAAQNTLGTVDILINNAGVQHVAPLVAFPEDKWDLLLAVNLSAAFHA
TKAVMPAMLARGFGRVVNIASALGLVGAPHKPAYVATKHGLIGLTRSVALEVAQGGVTCN
VVCPGMVMTPIIEMQVADQARVTGLPPEEVVREVFLENQPIRRPVKAEEIAAAVVFLCSE
AAAGITGTVLSVDGGYTAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacgcaacgccgtcgtcaccgggtccacgtccggcatcgggctcgcgattgca
aggtcacttgccgccgaaggctgcaacgtgatgctcaacggcttcggagaacccgcccag
atcgaaatggtccgccgtgagatggccgaaaccacgggatgcaccatcggctactccggc
gcggacatgggacgtccggaggaggtccgcgccctcattgcggcggcgcagaacacgctc
gggaccgtcgatatcctgatcaacaatgccggcgtgcagcatgtggcgcccctcgtcgcg
ttcccggaggacaaatgggacctgctgctggccgtcaacctctcggccgccttccacgcc
accaaggcggtaatgccggccatgcttgcgcgcggcttcggcagggtcgtgaacatcgcc
tccgctctggggctggtgggcgcgccgcataagcccgcctatgtggccacgaagcacggc
ctcatcgggctcacccggtccgtcgcgctcgaggtggcacagggcggggtgacctgcaac
gtcgtgtgccccggcatggtcatgacccccatcatcgagatgcaggtggcggatcaggcg
cgcgtcaccggcctgccgcccgaggaagtggtgcgggaggtgttccttgaaaaccaaccc
atccggcgtccggtcaaggcggaggagatcgcggcggcggttgtcttcctctgctcggag
gcggcggccgggatcaccggaaccgtgctctcggtggacggaggctataccgcgcggtga

DBGET integrated database retrieval system