KEGG   Azorhizobium caulinodans: AZC_3276Help
Entry
AZC_3276          CDS       T00609                                 

Definition
c-type cytochrome
Orthology
K08738  
cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AZC_3276
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3782825..3783211)
Genome map
AA seq 128 aa AA seqDB search
MAFRQTPLIMCLALTLLGTGGAAHAQDAAAGERLFRARCASCHAVESGQNRIGPSLSGVI
GRKAGSLEGARYSQGMRALDVTWDAAQLDTYLANPRAMVPGTTMTVSVTSAADRAAITGY
LQTLSQPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcggcagacgcccctgatcatgtgccttgccctgacactgctgggaacggga
ggcgcggcccatgcgcaggatgctgccgccggcgaacgcctgttccgcgcgcgctgtgcg
tcgtgccacgccgtcgaatccggccagaaccggatcggcccgagcctgagcggggttatc
ggccgcaaggcgggcagcctcgaaggcgcccgctattcgcaaggtatgagggcactcgat
gtgacctgggatgcggcgcagttggacacgtatctcgctaatccgcgcgcgatggtgccc
ggcacgaccatgacggtttcggtgacgagcgccgcggaccgcgccgcgatcaccggctac
ctgcagaccctttcgcagccgaagtga

DBGET integrated database retrieval system