KEGG   Azorhizobium caulinodans: AZC_3520Help
Entry
AZC_3520          CDS       T00609                                 

Definition
FAD-binding oxidoreductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
azc  Azorhizobium caulinodans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:azc00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:azc00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:azc00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4041210..4044686)
Genome map
AA seq 1158 aa AA seqDB search
MSETSTPPALKSVDLGLAAGTVRVGWFPGASREAVLAAVRGAAGLSGETAFHVETADGVT
IALDDSVPAGTRLRLVVQGEVPSSAAPALHRPVPGPKPYPVVGNLPELHNAEGLVAAVDA
LHAKHGEFFAFQVGGKRAYFCSDADIISEMCAAPDVFAKLVEGRGGLGNLAEKSVGSALF
TASDNDPLWHQAHRILAPAFGATALKNYYGRIVEVADDLLDHLDRLAPGESFLATDLMTR
MTFEAISYAAFNRRYGAIDSPALPAFVEAMNVVLTDAMAEPKRLLPEVFYHEARKTRAAA
DKIMLEEVETIIAERRFAMAAGAPVPTDLLQVMLTTPDRVTGQKLPDDNIRGQLIVLLIA
GHETTSGMLAYALYHLWKYPETMEKLIAEVDEVLGRDFSYKPTYEDVGRLAYTQRVLKEA
LRLCPPVPMFPRYVTRDATVGNGRYDLKAGERIFVSLSAMQKNPRFWGADALVFRPERFG
PEEEKHHHPHAYHPFGMGARSCIGFQFALVEAKMVLARFIQRFTARPKDPHYVLCHKQAL
TVKPDHLDMLLERRPEVKGRFPVRTEAPKTQGAPLAVAQAGGRPMRVLYGSNMGGCRDIA
LSLAQQAGARGFAATVAELDEQVGQPWLTDGPVVIVTSTYNGTPPDNAARFAKWLETAPA
GVCAGVRHAVLGCGNTQWHQTFQKFPKTIASGLAALGGTALLDEGTADAAGDYEAAVEGW
TAALWPALEAAFGGAAGAAVIGSAEAAAEAPAVKVEVVNFAGAATGAAPRTGTRLDQGAQ
LSRIRVNRELLSPGAQGSTRHIEIPLPAGTSYAAGDHLAVFPVNPPALVAAAAARCGLAP
ETQVLLTALHPDAASEAGLPFGVPVSVGELLAEHVDLAGPVTRRDLRAWAQAAQCPPDRA
RIAGWLSDFPSAVAEAKPRMEDLLAQVPSVQLDLAALLTVRPALKPRYYSISSSPLMSPD
ACALTVGVHQFTTADGVRHDGLCSSYLVSCGEDAPVRVLVKDTGSTFHLPADPAVPLILV
GPGTGLAPLRGFIQERHALRAQGRATGPVLLFFGCRDDGDYLYREELEAYRDEGTLSLLA
VGFSRRPGTPRTYVQDLLRTHGDAVREQVAAGASILICGNARTMAPDVHAAFLELLGAGA
VAELEAGGRYLQDVWASS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacctcgacgcctccggccctgaagagcgtggacctcggccttgcggccggc
accgtccgggtcggctggtttccgggcgcgagccgggaggcggtgctggccgccgtgcgc
ggggcggcgggcctctcgggcgagaccgctttccatgtggagacggcggatggggtcacc
atcgcccttgatgacagcgtgcctgccggcacgcggctgcggctggtggttcagggcgag
gtgccgtcttcagctgccccggcgctccaccggcccgtgcccggccccaagccctatccc
gtcgtcggcaacctgcccgaactgcacaatgccgagggtctcgtggcggcggtggatgcc
ctgcacgccaagcacggcgaattcttcgcgtttcaggtgggcggcaagcgcgcctatttc
tgctcggacgccgacatcatctcggagatgtgcgccgcgcccgatgtgtttgccaagctg
gtggagggacgcggcggcctcgggaatctggccgagaagagcgtcggcagcgcgctgttc
acggcgagtgacaatgatccgctctggcaccaagctcatcgcatcctcgccccggccttc
ggcgccacggcgctgaagaactattacggccgtatcgtcgaggtggccgacgacctgctc
gaccatctcgaccgcctcgcgcccggcgagagcttcctcgccaccgacctgatgacgcgg
atgaccttcgaggccatctcctatgctgccttcaaccggcgctacggggccatcgattcc
cccgcgcttccggccttcgtggaggccatgaacgtggtgctcacggacgccatggccgag
cccaagcgcctgctgccggaggtgttctatcacgaggcccgcaagacccgcgcggccgcc
gacaagatcatgctggaggaggtggagaccatcatcgccgagcgccgcttcgccatggcc
gcaggcgcgccggtgccgaccgatctgctgcaggtgatgctcaccacgcctgatcgtgtg
acggggcagaagctgcccgacgacaatatccgcggccagctcatcgtgctgctcatcgcc
gggcacgagaccacctccggcatgctggcctatgcgctctatcacctctggaagtatccc
gagacgatggagaagctcattgccgaggtggacgaggtgctgggccgggacttctcctac
aagcccacctatgaggacgtcggccggctcgcctacacccagcgggtgctgaaggaggcg
ctgcgcctctgcccgccggtgcccatgttcccgcgctatgtcacccgcgatgcgaccgtt
ggcaacggccgctatgacctgaaggcgggcgagcgcatcttcgtctcgctctcggccatg
cagaagaacccgcgcttctggggcgcggatgcgctggtcttccgccccgagcgcttcggg
ccggaggaagagaagcaccaccatccccatgcctaccaccccttcggcatgggcgcgcgc
tcgtgcatcggcttccagttcgctctggtggaagccaaaatggtgctggcccgcttcatc
cagcgcttcaccgcgcgtcccaaggatccgcattacgtgctgtgccacaagcaggcgctc
accgtgaagccggaccatctggatatgctgctggagcgccggccggaggtgaaaggacgc
tttccggtccgcactgaggctcccaagacgcaaggggcgcccctggcggtggcgcaggcc
ggcgggcggcccatgcgcgtgctctatggatcgaacatgggcggctgtcgggatatcgcg
ctcagcctcgcccagcaggcgggcgcacggggctttgccgcgaccgtggcggaactggac
gagcaggtgggccagccgtggctcaccgacgggcctgtggtgatcgtcacctccacctat
aatggcacgccgccggacaatgccgcccgcttcgccaaatggctcgagactgcgcccgct
ggcgtttgcgccggtgtgcggcacgccgtgctcggctgcggcaacacccaatggcaccag
accttccagaaattcccgaagaccattgcctcgggccttgccgcgctcggcggcacggcc
ctgctggacgagggcaccgcggatgcggcgggcgattacgaggcggcggtggagggctgg
accgccgccctctggccggcgcttgaggccgccttcggcggtgcggctggtgcagccgtg
attggtagcgccgaggcagccgcggaggccccggcggtgaaggtggaggtggtgaatttc
gcaggcgcggccaccggtgccgcgccccgcaccggcacccggctcgaccagggtgcgcaa
ctgtctcgcatacgggtcaatcgcgaactgctgtcccctggcgcccagggctcgacccgc
catatcgaaatcccgctgccggccggcacctcctatgccgccggcgatcatctcgccgtg
ttcccggtcaatccgccggctctggtcgccgccgccgctgcccgctgcggccttgcgcca
gagacgcaggtgctgctgaccgccctgcatccggatgccgccagcgaagccggattgccc
ttcggcgtgccggtgagcgtcggcgaactgctggctgagcacgtggaccttgccggcccc
gtcacgcggcgtgatcttcgggcctgggcgcaggcggcgcaatgcccgcccgaccgggcg
cggatcgccggctggctctccgattttcccagcgccgtggccgaggcgaagccgcgcatg
gaagacctgctggcgcaggtgccttccgtgcagctcgaccttgccgccctgctcaccgtg
cgcccggcgctgaagccgcgctattattccatctcctcttcgcccttgatgtcgccggat
gcgtgcgcgctcaccgtgggcgtgcatcagttcaccaccgccgacggcgtgcgccatgac
ggcctgtgcagcagctatctcgtgagctgcggggaggacgcgccggtgcgcgtgcttgtg
aaggatacgggcagcacgttccaccttccggctgatcctgcggtgccgctcatcctggtg
gggccgggcaccggccttgcgcccctgcgcggcttcattcaggagcgccatgccctgcgg
gcgcaggggcgtgccacaggcccggtgctcctcttcttcggctgtcgggacgatggcgat
tatctctatcgcgaggaactggaggcctatcgcgacgaaggcacgctgagccttctggcg
gtgggcttctcccgccggccgggcacgccccggacctatgtgcaggatctgctgcggacc
catggtgatgcggtgcgcgaacaggtggcggccggcgcctccatccttatctgcggcaat
gcccgcaccatggcgcccgacgttcacgcggcctttttggagcttctcggggccggtgcg
gtggcggaactggaggccggcggtcgctatctgcaggacgtatgggcctcctcctga

DBGET integrated database retrieval system