KEGG   Azorhizobium caulinodans: AZC_3520Help
Entry
AZC_3520          CDS       T00609                                 

Definition
FAD-binding oxidoreductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
azc  Azorhizobium caulinodans
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AZC_3520
  Amino acid metabolism
   00380 Tryptophan metabolism
    AZC_3520
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AZC_3520
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AZC_3520
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AZC_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4041210..4044686)
Genome map
AA seq 1158 aa AA seqDB search
MSETSTPPALKSVDLGLAAGTVRVGWFPGASREAVLAAVRGAAGLSGETAFHVETADGVT
IALDDSVPAGTRLRLVVQGEVPSSAAPALHRPVPGPKPYPVVGNLPELHNAEGLVAAVDA
LHAKHGEFFAFQVGGKRAYFCSDADIISEMCAAPDVFAKLVEGRGGLGNLAEKSVGSALF
TASDNDPLWHQAHRILAPAFGATALKNYYGRIVEVADDLLDHLDRLAPGESFLATDLMTR
MTFEAISYAAFNRRYGAIDSPALPAFVEAMNVVLTDAMAEPKRLLPEVFYHEARKTRAAA
DKIMLEEVETIIAERRFAMAAGAPVPTDLLQVMLTTPDRVTGQKLPDDNIRGQLIVLLIA
GHETTSGMLAYALYHLWKYPETMEKLIAEVDEVLGRDFSYKPTYEDVGRLAYTQRVLKEA
LRLCPPVPMFPRYVTRDATVGNGRYDLKAGERIFVSLSAMQKNPRFWGADALVFRPERFG
PEEEKHHHPHAYHPFGMGARSCIGFQFALVEAKMVLARFIQRFTARPKDPHYVLCHKQAL
TVKPDHLDMLLERRPEVKGRFPVRTEAPKTQGAPLAVAQAGGRPMRVLYGSNMGGCRDIA
LSLAQQAGARGFAATVAELDEQVGQPWLTDGPVVIVTSTYNGTPPDNAARFAKWLETAPA
GVCAGVRHAVLGCGNTQWHQTFQKFPKTIASGLAALGGTALLDEGTADAAGDYEAAVEGW
TAALWPALEAAFGGAAGAAVIGSAEAAAEAPAVKVEVVNFAGAATGAAPRTGTRLDQGAQ
LSRIRVNRELLSPGAQGSTRHIEIPLPAGTSYAAGDHLAVFPVNPPALVAAAAARCGLAP
ETQVLLTALHPDAASEAGLPFGVPVSVGELLAEHVDLAGPVTRRDLRAWAQAAQCPPDRA
RIAGWLSDFPSAVAEAKPRMEDLLAQVPSVQLDLAALLTVRPALKPRYYSISSSPLMSPD
ACALTVGVHQFTTADGVRHDGLCSSYLVSCGEDAPVRVLVKDTGSTFHLPADPAVPLILV
GPGTGLAPLRGFIQERHALRAQGRATGPVLLFFGCRDDGDYLYREELEAYRDEGTLSLLA
VGFSRRPGTPRTYVQDLLRTHGDAVREQVAAGASILICGNARTMAPDVHAAFLELLGAGA
VAELEAGGRYLQDVWASS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacctcgacgcctccggccctgaagagcgtggacctcggccttgcggccggc
accgtccgggtcggctggtttccgggcgcgagccgggaggcggtgctggccgccgtgcgc
ggggcggcgggcctctcgggcgagaccgctttccatgtggagacggcggatggggtcacc
atcgcccttgatgacagcgtgcctgccggcacgcggctgcggctggtggttcagggcgag
gtgccgtcttcagctgccccggcgctccaccggcccgtgcccggccccaagccctatccc
gtcgtcggcaacctgcccgaactgcacaatgccgagggtctcgtggcggcggtggatgcc
ctgcacgccaagcacggcgaattcttcgcgtttcaggtgggcggcaagcgcgcctatttc
tgctcggacgccgacatcatctcggagatgtgcgccgcgcccgatgtgtttgccaagctg
gtggagggacgcggcggcctcgggaatctggccgagaagagcgtcggcagcgcgctgttc
acggcgagtgacaatgatccgctctggcaccaagctcatcgcatcctcgccccggccttc
ggcgccacggcgctgaagaactattacggccgtatcgtcgaggtggccgacgacctgctc
gaccatctcgaccgcctcgcgcccggcgagagcttcctcgccaccgacctgatgacgcgg
atgaccttcgaggccatctcctatgctgccttcaaccggcgctacggggccatcgattcc
cccgcgcttccggccttcgtggaggccatgaacgtggtgctcacggacgccatggccgag
cccaagcgcctgctgccggaggtgttctatcacgaggcccgcaagacccgcgcggccgcc
gacaagatcatgctggaggaggtggagaccatcatcgccgagcgccgcttcgccatggcc
gcaggcgcgccggtgccgaccgatctgctgcaggtgatgctcaccacgcctgatcgtgtg
acggggcagaagctgcccgacgacaatatccgcggccagctcatcgtgctgctcatcgcc
gggcacgagaccacctccggcatgctggcctatgcgctctatcacctctggaagtatccc
gagacgatggagaagctcattgccgaggtggacgaggtgctgggccgggacttctcctac
aagcccacctatgaggacgtcggccggctcgcctacacccagcgggtgctgaaggaggcg
ctgcgcctctgcccgccggtgcccatgttcccgcgctatgtcacccgcgatgcgaccgtt
ggcaacggccgctatgacctgaaggcgggcgagcgcatcttcgtctcgctctcggccatg
cagaagaacccgcgcttctggggcgcggatgcgctggtcttccgccccgagcgcttcggg
ccggaggaagagaagcaccaccatccccatgcctaccaccccttcggcatgggcgcgcgc
tcgtgcatcggcttccagttcgctctggtggaagccaaaatggtgctggcccgcttcatc
cagcgcttcaccgcgcgtcccaaggatccgcattacgtgctgtgccacaagcaggcgctc
accgtgaagccggaccatctggatatgctgctggagcgccggccggaggtgaaaggacgc
tttccggtccgcactgaggctcccaagacgcaaggggcgcccctggcggtggcgcaggcc
ggcgggcggcccatgcgcgtgctctatggatcgaacatgggcggctgtcgggatatcgcg
ctcagcctcgcccagcaggcgggcgcacggggctttgccgcgaccgtggcggaactggac
gagcaggtgggccagccgtggctcaccgacgggcctgtggtgatcgtcacctccacctat
aatggcacgccgccggacaatgccgcccgcttcgccaaatggctcgagactgcgcccgct
ggcgtttgcgccggtgtgcggcacgccgtgctcggctgcggcaacacccaatggcaccag
accttccagaaattcccgaagaccattgcctcgggccttgccgcgctcggcggcacggcc
ctgctggacgagggcaccgcggatgcggcgggcgattacgaggcggcggtggagggctgg
accgccgccctctggccggcgcttgaggccgccttcggcggtgcggctggtgcagccgtg
attggtagcgccgaggcagccgcggaggccccggcggtgaaggtggaggtggtgaatttc
gcaggcgcggccaccggtgccgcgccccgcaccggcacccggctcgaccagggtgcgcaa
ctgtctcgcatacgggtcaatcgcgaactgctgtcccctggcgcccagggctcgacccgc
catatcgaaatcccgctgccggccggcacctcctatgccgccggcgatcatctcgccgtg
ttcccggtcaatccgccggctctggtcgccgccgccgctgcccgctgcggccttgcgcca
gagacgcaggtgctgctgaccgccctgcatccggatgccgccagcgaagccggattgccc
ttcggcgtgccggtgagcgtcggcgaactgctggctgagcacgtggaccttgccggcccc
gtcacgcggcgtgatcttcgggcctgggcgcaggcggcgcaatgcccgcccgaccgggcg
cggatcgccggctggctctccgattttcccagcgccgtggccgaggcgaagccgcgcatg
gaagacctgctggcgcaggtgccttccgtgcagctcgaccttgccgccctgctcaccgtg
cgcccggcgctgaagccgcgctattattccatctcctcttcgcccttgatgtcgccggat
gcgtgcgcgctcaccgtgggcgtgcatcagttcaccaccgccgacggcgtgcgccatgac
ggcctgtgcagcagctatctcgtgagctgcggggaggacgcgccggtgcgcgtgcttgtg
aaggatacgggcagcacgttccaccttccggctgatcctgcggtgccgctcatcctggtg
gggccgggcaccggccttgcgcccctgcgcggcttcattcaggagcgccatgccctgcgg
gcgcaggggcgtgccacaggcccggtgctcctcttcttcggctgtcgggacgatggcgat
tatctctatcgcgaggaactggaggcctatcgcgacgaaggcacgctgagccttctggcg
gtgggcttctcccgccggccgggcacgccccggacctatgtgcaggatctgctgcggacc
catggtgatgcggtgcgcgaacaggtggcggccggcgcctccatccttatctgcggcaat
gcccgcaccatggcgcccgacgttcacgcggcctttttggagcttctcggggccggtgcg
gtggcggaactggaggccggcggtcgctatctgcaggacgtatgggcctcctcctga

DBGET integrated database retrieval system