KEGG   Azorhizobium caulinodans: AZC_3765Help
Entry
AZC_3765          CDS       T00609                                 

Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
azc  Azorhizobium caulinodans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AZC_3765
Enzymes [BR:azc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZC_3765
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AZC_3765
Lipid biosynthesis proteins [BR:azc01004]
 Fatty acid synthase
  Component type
   AZC_3765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4319804..4320232
Genome map
AA seq 142 aa AA seqDB search
MSGDTSTQGLARLDWSVPPGTDAVIVELGANDMLRGQDPNITRRTLDEILTRLKGRNIPV
LLAGMRAAPNFGADYQKAFDAIYPDLASKHGVLLYPFFLDGVAGDRSLNQADGMHPTAAG
VNRIVPAILPSVEKLLAETSQH
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcgacacctccacgcagggcctcgcgcggctggactggtccgtaccacccggc
accgatgcagtgatcgtcgagctgggcgccaatgacatgctgcgcggacaggatccgaac
atcacacggcgcacgctggacgagatcctgacccggctgaagggccgcaatatccccgtg
ctgctggccgggatgcgggccgcgcccaatttcggcgccgactaccagaaggcctttgat
gccatctatcccgatctggcgagcaagcacggcgtgctgctctatcccttctttctcgat
ggcgttgctggagatcgcagcctcaatcaggccgacggcatgcaccccacggcggccggc
gtgaaccgcatcgtgccggccattctgcccagcgtcgaaaaacttctggcagagaccagc
caacactag

DBGET integrated database retrieval system