KEGG   Azorhizobium caulinodans: AZC_3992Help
Entry
AZC_3992          CDS       T00609                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AZC_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4559730..4560638
Genome map
AA seq 302 aa AA seqDB search
MHDILYEGGPTGLLLIHGLGGTPVELKRIARAVHAAGHTAYCCTLAGHCGTEADLVATRW
QDWYASVEAAFDRLSARCERVVVGGLSLGAVLALHLAARRGSDVHGLALYAPTLWYDGWA
MPWYRALLKVAVYTPIGRRYRFVEREPFGIRDARIRARVAAAMLGGDSAEAGLAGTPAHA
LRELWRISARVRRELPEVKAPAILLHARTDDISSLRNSTHIAGRLGGIADLTVLDDSYHI
VTLDRQRNVVIERTLALMSRIGVTGAKPVMLRQSSTPMPLATLRDVPGGRRRPSHAFAEA
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgacatcctgtacgagggcggcccgacaggcctgctgctcatccacggcctcggt
ggtacacccgtcgagctgaagcgcatcgcgcgggccgtccacgcggcggggcacaccgcg
tattgctgcacgctcgcgggtcattgcgggacggaggccgatctcgtcgccacacgctgg
caggactggtacgcgagcgtggaagccgcgttcgaccgcctctctgcccggtgcgagcgg
gtggtggtcggcgggctgtcgctcggtgccgtgctggccctgcatctggcggcccgacgc
ggatcggacgtgcatggccttgccctttatgccccgacgctctggtacgacggctgggcc
atgccgtggtatcgcgcgctgctgaaggtcgcggtctatacgcccatcggccgccgttac
cggttcgtggagcgcgagcccttcggcatccgcgatgcgcgcatccgcgcccgcgtcgcc
gccgccatgctggggggcgacagcgcggaggctggtcttgccggaacgccggcccatgcc
cttcgggagctatggcggatcagcgcccgcgtccggcgggagctgccggaggtgaaggcc
ccggccatcctgctgcatgcccgcacggacgatatcagcagcctgcgcaacagcacccat
attgccgggcgtctcggtggcatcgcagacctgacggtgctggacgacagttaccacatc
gtgacgctggaccggcagcgcaacgtcgtcatcgaacgcacgctcgccctcatgtctcgc
atcggcgtcacgggtgcgaagcccgtaatgttgcggcaatccagcacccccatgcctctc
gccacgctgcgggatgtccccggtggccgacggcgcccgtcccacgcgttcgccgaagcc
gcccggtga

DBGET integrated database retrieval system