KEGG   Azorhizobium caulinodans: AZC_4011Help
Entry
AZC_4011          CDS       T00609                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00020  Citrate cycle (TCA cycle)
azc00310  Lysine degradation
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
Module
azc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZC_4011
  Amino acid metabolism
   00310 Lysine degradation
    AZC_4011
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AZC_4011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAF90009
RhizoBase: AZC_4011
UniProt: A8ILB1
Position
complement(4576821..4578059)
Genome map
AA seq 412 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKPGDAVKADEPLVELETDKVTVEVPAPAAGVLSEII
AKDGDTVGVGALLGAIAEGAAGAAAAAPKAEAPKAAPAPAAAPAPAPAAAPAKAASGANG
PAVERLAAETGVSAANVAGSGKDGRVTKGDMLAAIASGAAAPAAAPAPVAVRAPSAPVDA
AREERVKMTKLRQTIARRLKDAQNTAAMLTTFNDVDMSAVMGLRAQFKDSFEKKHGTKLG
FMGFFTKAVIAALKDLPAVNAEIDGQDIVYKNYYNIGIAVGTEKGLVVPVVRDADELSVA
GIEKAIAGFGRKARDGKLGIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHRIEE
RPVVVKGQIVVRPMMYLALSYDHRIVDGREAVTFLVRVKETLEDPARLVLDL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaaatccgcgtgcccaccctgggcgagtccgttaccgaggccaccatcggc
aagtggttcaagaagcctggcgatgcggtgaaggccgacgagccgctggtggaactggag
accgacaaggtcaccgtcgaggttcccgccccggccgctggcgtcctctccgaaatcatc
gccaaggacggtgacaccgtcggcgtcggcgccctcctcggcgcgatcgccgaaggcgct
gccggcgctgctgccgccgctccgaaggccgaggcccccaaggcggctccggctccggcc
gctgcgcccgctccggcgcctgccgccgccccggccaaggccgcttccggcgccaatggc
ccggcggtcgagcgtctcgccgccgagaccggcgtgtccgccgccaacgtcgccggctcc
ggcaaggatggccgcgtgaccaagggcgacatgctggccgccatcgcctccggcgctgcc
gctccggccgctgccccggcgccggtcgccgtccgcgccccctccgcgccggtggatgcc
gcgcgcgaagagcgcgtgaagatgaccaagctgcggcagaccatcgcccgccgcctgaag
gacgcccagaacaccgccgccatgctcaccacgttcaacgacgtggacatgagcgcggtg
atgggcctgcgcgcccagttcaaggactccttcgagaagaagcacggcaccaagctcggc
ttcatgggcttcttcaccaaggccgtcatcgcggccctgaaggacctgccggcggtgaac
gccgagatcgacggtcaggacatcgtctacaagaactactacaacatcggtatcgcggtg
ggcaccgagaagggcctcgtggtcccggtggtgcgtgacgccgacgagctgtcggtggcc
ggcatcgagaaggccatcgccggcttcggccgcaaggcccgtgacggcaagctcggcatc
gaggacatgcagggcggcaccttcacgatcaccaacggcggcatctacggctcgctgatg
tccacccccatcctcaacgcgccgcagtccggcatcctcggcatgcaccgcatcgaggag
cgtccggtggtggtcaagggccagatcgtcgtgcgcccgatgatgtatctcgcgctctcc
tacgaccaccgcatcgtcgacggccgcgaggccgtgaccttcctggtgcgcgtgaaggag
acgctggaggatcccgcgcgtctcgtgctcgacctctga

DBGET integrated database retrieval system