KEGG   Azorhizobium caulinodans: AZC_4015Help
Entry
AZC_4015          CDS       T00609                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
azc  Azorhizobium caulinodans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZC_4015
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZC_4015
   00640 Propanoate metabolism
    AZC_4015
   00660 C5-Branched dibasic acid metabolism
    AZC_4015
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AZC_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(4582611..4583813)
Genome map
AA seq 400 aa AA seqDB search
MNIHEYQAKALLKTYGAPVSRGVPVLAVGEAEAAARELGGPLWVVKSQIHAGGRGKGKFK
EPEAGDKGGVRLARSVEEVKTFVEQMLGNTLVTVQTGPAGKQVNRLYIEEGSDIETEFYL
SLLVDRSTSRVSFVVSTEGGMDIEEVAHSTPEKIVSFSVDPASGIQAFHGRKVADALGLS
GDLAKQAGKLTEVLYTAFTDTDMAMLEINPLIVTKDAKLKVLDAKVTFDSNALFRHPDLL
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGESPANFLDVG
GGASEEKVTAAFKIITSDPNVKGILVNIFGGIMKCDVIARGVLAAVTAVGLKVPLVVRLE
GTNVEQGKQIIRDSGLNVIPADDLDDAAQKIVAAVKKEAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggcgaaggccctgctgaagacctacggtgcgcccgtgtct
cgcggcgtgccggtcttggcggtgggcgaggccgaggcggccgcgcgtgagctgggcggc
ccgctctgggtcgtgaagtcgcagatccatgccggcggccgcggcaagggcaagttcaag
gagccggaagccggcgacaagggcggcgtgcggctggcccggtcggtggaagaggtgaag
accttcgtcgagcagatgctcggcaacacgctcgtgaccgtgcagaccggcccggccggc
aagcaggtgaaccgcctctacatcgaggaaggttccgacatcgagaccgagttctacctc
tcgctcctcgtggaccgctccacctcgcgcgtctccttcgtggtctccaccgaaggcggc
atggacatcgaggaagtggcgcactccacccctgagaagatcgtctccttctcggtggac
ccggcctccggcatccaggctttccacggccgcaaggtggccgatgcgctcggcctctcc
ggcgacctcgccaagcaggcgggcaagctgaccgaggtgctctacaccgccttcaccgac
accgacatggcgatgctggagatcaatccgctcatcgtcaccaaggatgccaagctgaag
gtgctggacgccaaggtgacgttcgattccaacgcgctgttccgccatccggacctgctc
gccctgcgcgacgagacggaagaggacgccaaggagatcgaagcctccaagtatgacctc
gcctacatcgcgctcgacggcacgatcggctgcatggtgaacggcgcgggcctcgcgatg
gcgaccctcgacatcatcaagctctatggcgagagcccggccaacttcctcgacgtgggc
ggcggcgccagcgaggagaaggtgacggcggccttcaagatcatcacctcggacccgaac
gtgaagggcatcctggtgaacatcttcggcggcatcatgaagtgcgacgtgatcgcgcgc
ggcgtgctcgccgcggtgaccgccgtcggcctcaaggttccgctggtggtgcgcctcgaa
ggcaccaacgtggagcagggcaagcagatcatccgcgacagcggcctgaacgtgatccct
gccgatgacctggacgatgcggcgcagaagatcgtcgcggccgtgaagaaggaagctgcg
tga

DBGET integrated database retrieval system