KEGG   Azorhizobium caulinodans: AZC_4090Help
Entry
AZC_4090          CDS       T00609                                 

Definition
(GenBank) invasion protein A
  KO
K08311  
putative (di)nucleoside polyphosphate hydrolase [EC:3.6.1.-]
Organism
azc  Azorhizobium caulinodans
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:azc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AZC_4090
Enzymes [BR:azc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     AZC_4090
Messenger RNA biogenesis [BR:azc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     AZC_4090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(4660473..4660979)
Genome map
AA seq 168 aa AA seqDB search
MTRLEDLPYRPCVGLAIFNRAGQVFLGQRLSGPEHVDATHSWQMPQGGIDKGEEPYEAAL
RELYEETSIRSVVKLGEVEDWLSYDLPGRVAGEAWKGKYRGQTQKWFALRFTGDEGEIDI
LKPGGGAHKAEFCNWRWDALDRAAELVIPFKRQVYERVAREFRRFAHD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtcttgaggatcttccctatcgcccctgcgtgggcctcgccatcttcaatcgt
gcaggccaggtgttcctcggccagcgcctgagcggccccgagcatgtggatgccacccat
tcctggcagatgccccagggcggcatcgacaagggcgaggagccctatgaggcggccctc
cgcgagctgtatgaggagacctcgatccgctccgtggtgaagctgggcgaggtggaggac
tggctgtcctacgatctgccgggccgcgtggcgggagaggcctggaagggcaagtatcgt
ggccagacccagaagtggttcgcgctgcgtttcaccggcgacgaaggcgagatcgacatc
ctcaagcccggtggcggcgctcacaaggccgagttctgcaactggcgctgggacgcgctg
gaccgggcagccgaactggtgatccccttcaagcggcaggtgtacgaacgcgtggcccgc
gaattccgccgcttcgcgcatgactga

DBGET integrated database retrieval system