KEGG   Azorhizobium caulinodans: AZC_4116Help
Entry
AZC_4116          CDS       T00609                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
azc  Azorhizobium caulinodans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZC_4116
Enzymes [BR:azc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AZC_4116
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZC_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4693760..4696009
Genome map
AA seq 749 aa AA seqDB search
MPRRPHIHWRVLMTLADPIDRTLAPEAGALAALVEGRHGDPFSLLGRHMVDGTPVVRTFQ
PGAAAVEARVGPAGITVQLAKIHPAGLFAGRLPEGAGPYLLRITWPDGTVEETEDPYAFG
PLLGDLDLYLIAEGTHLDLSETLGAHVVRVGDVEGVRFALWAPNARRVSVVGDFNLWDGR
RHPMRLRQSGVWEIFLPGVRAGARYKFELLGPDGTLLPLKADPLARAAELPPATASIVSS
PAPFHWSDAAWMAGRAGRQGPEAPISIYEVHPGSWIRIEADGHRSPNWDELADRLLPYVQ
RMGFTHVEFLPIMEHPFGGSWGYQPLGLFAPTARFGPPEAFARFVDRCHAAGIGVILDWV
PAHFPNDAHGLGHFDGTALYEHADPREGFHPDWNTLIYNFGRREVSGFLIASALEWLRRF
HVDGLRVDAVASMLYRDYSRKPGEWVPNIHGGRENLEAVAFLQRLNAMVAEQAPGAIVIA
EESTAWPGVTAPVSEGGLGFSFKWNMGWMHDTLRYIEHDSIHRRHHHDDITFGLVYAFSE
RFILPISHDEVVHGKGSLLARMPGDDWQRMANLRAYLGLMWGHPGKKLLFMGCEIAQPDE
WNHDGVVPWHLLEQPAHAGIQKLVADLNATYADLPALHARDATPDGFSWIIGDDSANSVF
AFFRHAPGAPPVLVVANMTPVPREAYRIGVPDGGPWREAVNTDAAAYAGSGVGNGGTLEA
EAIESHGLPFSLSLTLPPLATLFLTPRQG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgtcggccccacatccattggagagtgctcatgaccctcgcggaccccatcgac
cgcacgcttgcgcccgaagccggcgccctcgcggcgctggtcgagggccgccatggcgac
cccttcagcctgctcggccggcacatggtggatggcacgcccgtcgtgcgcacttttcag
cccggcgccgccgccgtggaggcgcgcgtggggccagccggaataaccgtgcaactggca
aagatccaccccgccggcctgttcgccggccggctgccggagggcgcaggcccctatctc
ctgcgcatcacctggccggacggcaccgtggaggagaccgaggacccttacgccttcggc
ccactgctgggcgatctcgacctctatctgatcgctgagggcacccatctcgacctttcg
gagacgctcggcgcccatgtggtgcgggtcggagacgtggagggtgtgcgcttcgcgctt
tgggcgccgaacgcccggcgcgtttccgtggtgggcgatttcaacttatgggacggccgc
cgccatcccatgcggctgcgccaatcgggcgtgtgggaaatcttcctgcccggcgtgcgg
gccggcgcgcgttacaagttcgagctgctgggtccggacggcacgctgctgccgctgaag
gcggaccctctcgcccgcgcggcagagctgccgcccgccaccgcctccatcgtcagcagt
cccgcgccgttccactggagcgacgcggcatggatggctggccgcgccggccggcagggg
cctgaggcgcccatctccatctatgaggtgcatcccggctcctggatccgcatcgaggcg
gacggccaccgcagcccgaactgggatgaactcgccgaccggctgctcccctatgtgcag
cggatgggcttcacccacgtggagttcctgcccatcatggagcaccccttcggtggctcc
tggggctatcagccgctcggcctgttcgcgcccaccgcccgcttcggtccgccggaggcc
tttgcccgtttcgtggaccgctgccatgccgccggcatcggcgtgatcctcgactgggtg
ccggcgcactttcccaatgacgcccacggcctcggccatttcgacggcacggcgctttat
gagcatgctgatccgcgggagggcttccaccccgactggaacacgctgatctacaatttc
gggcggcgcgaggtgtccggcttcctcatcgcctcggccctggaatggctgcggcgcttc
catgtggacgggctacgcgtcgatgcggtggcctcgatgctctaccgcgactattcccga
aagcccggcgagtgggtcccgaacatccatggcgggcgcgagaatctggaggcggtcgcc
ttcctccagcggctcaacgccatggtcgcggaacaggcaccgggcgcgatcgtcatagcg
gaggaaagcaccgcgtggcccggcgtcacggcgccggtgagcgagggcgggctcggcttt
tccttcaagtggaacatgggctggatgcacgacacgctgcgctacatcgagcacgacagt
atccaccgccgccatcaccacgacgacatcaccttcggcctcgtctacgctttctccgag
cgcttcatcctgcccatctcccacgacgaggtggtacacggcaaaggctcgttgctggcc
cgcatgcccggcgacgactggcagcgcatggcgaacctgcgcgcctatctcgggctcatg
tggggccatccgggcaagaagctgctgttcatgggctgcgagatcgcccagccggacgag
tggaaccacgacggcgtcgttccgtggcatctgctggagcagcctgcccatgcgggcatt
cagaagctggtggccgacctcaacgccacctatgcggacctgccggccctccatgcccgc
gacgcgacgccggacggcttctcctggatcatcggggacgacagcgccaattccgtcttc
gccttcttccgtcacgcgcccggcgcgccgccggtgctggtggtcgccaacatgacgccg
gtgccgcgcgaggcctatcgcatcggcgtgccggacggcggcccgtggcgcgaggcggtc
aatacggacgccgcggcctatgctggctcgggcgtgggcaatggcggcacgctagaggcg
gaggccatcgagagccacggcctgcccttcagcctgtccctcaccctgccgccgcttgcc
accctcttcctgacgccgcgccaaggctga

DBGET integrated database retrieval system