KEGG   Azorhizobium caulinodans: AZC_4117Help
Entry
AZC_4117          CDS       T00609                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
azc  Azorhizobium caulinodans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZC_4117
Enzymes [BR:azc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AZC_4117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4696018..4698078
Genome map
AA seq 686 aa AA seqDB search
MDDTLHDLARAAGVSPHWHDAFGRPQTVPPHALRAILGALGLPAKTDALARESLDGLRHT
AVPTPPLVTGDVGAPLRVPLPGSGPLRWRITLEDGGLVEGESQGGGLDLPALNVPGYHRL
EAGGLDVTLAIAPERCSSIADATGDERARLWGLGIQLYGLKRPGDGGIGDFTALSDFVRH
AAGTGASATVLSPVHAAFSADPHHFSPYAPSSRLFLNVLHVDPAGLFGTDAVRQAADALA
LGGILSACESAPLVDWVRAGPARLALLRRLFDTELPARPDLVASYADFRRAQGQALEDHA
RFEALHAHIWGSDLHRWNWRTWPGEYRDATSPAVAAFAREHGSEVEFHAFLQWAAARGLA
SAQAAARAAGMPVGLIGDLAVGCDGGGSQCWSAPDDMLIGLSIGAPPDLLNSLGQAWGLA
AFSPRALVASGFRSFIAMLRASMAHVGGVRIDHVMGLLRLWMVPDGADPKDGAYLAYPFE
DLIRLVALESQRHRTIVTGEDLGTVPDGFRETLARRQILGMQVLWFEREGPRFKTAGEYL
PTAMAVTGTHDLPTVAGWWRGRDIDWRAPLGLLGEGIDEPAARAEREADRHALWSTIGDG
TPPPAATEPDAAVDAALGFVGRTTAPLVIIPLEDVLGESEQPNLPGTVDDHPNWRRRQPE
ATAQLLDRPEVKRRVALLDQARQPLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggacgataccctccacgacctcgcgcgcgcggccggcgtctcgccgcactggcacgat
gccttcggccgcccgcagacggtgccgccccatgccctgcgcgccatcctcggtgcgctc
ggcttgccggccaagaccgatgcgctggcgcgcgagagccttgacggcctccggcacacg
gcggtccccaccccgccgctcgtgaccggcgacgtgggcgcgcccctgcgcgtgcccctg
cccggcagcgggccgctgcgctggcgcatcacgctggaagatggtgggctggtggagggc
gagagccaaggcggcgggctcgacctgcccgcgctcaacgtgcccggctatcacaggctg
gaggcgggcggactggacgtgacgctcgccatcgcgccggagcggtgctcttccatcgcc
gacgccaccggagacgaacgggcccggctttggggactggggatccagctctatggactg
aagcggccgggcgacggcggcatcggcgacttcaccgccctgtccgatttcgtgcgccac
gccgcgggcaccggtgcctcggccacggtgctgagcccggtgcatgcggccttctcggcc
gatccgcatcacttcagcccctatgcaccatcgagccggctcttcctcaacgtgctgcat
gtggaccccgccggcctgttcggcaccgatgccgtgcggcaggccgcggacgctctcgcc
ctcggcggcatactctccgcctgcgagagcgctccgctggtggattgggtgcgcgccggc
ccggcgcgcctcgccctgttgcgccgcctgttcgacaccgaactgccggcgcgcccggat
ctcgttgcctcctatgcggacttccgccgcgcccagggccaggccctcgaggaccacgcg
cgcttcgaggcgctgcatgctcatatctggggctcggaccttcaccgctggaactggcgc
acctggcccggcgagtaccgcgatgcgacgagcccggcggtagcggcctttgcccgcgag
cacggatcggaggtggaattccacgccttcctgcaatgggcggcggcgcgtggcctggcg
agcgcgcaggcggccgcccgcgcggccggcatgcccgtgggcctcatcggcgatctggcg
gtgggctgcgacggcggcggcagccagtgctggagcgcgccggacgacatgctgatcggc
ctctccatcggcgcaccgccggacctgctcaactcgctcgggcaggcctgggggctcgcc
gccttttccccgcgcgccctcgttgcctcgggtttccgctccttcatcgccatgctgcgc
gccagcatggcccatgtgggtggggtgcggatcgaccatgtgatgggcctgctgcgcctg
tggatggtgccggacggggccgatccgaaggacggggcctatctcgcctaccccttcgag
gatctgatccggctggtggcgctggaatcccagcgccaccgcaccatcgtgaccggcgaa
gatcttggcaccgtgcccgatggcttccgcgagacgctcgcccgccggcagatcctcggc
atgcaggtgctgtggttcgagcgcgaggggccgcgcttcaagacggcgggcgaatatctg
cccaccgccatggcggtcaccggcacgcacgatttgcccaccgtcgccggctggtggcgc
gggcgcgacatcgactggcgcgcgcccctcggcctgctcggcgagggcatagacgagccg
gccgcgcgggccgagcgcgaagcggaccgtcacgccttgtggtcgaccatcggcgacggc
acgccgccacccgccgccaccgagccggatgccgcggtcgatgccgccctcggcttcgtc
gggcgcacgaccgcgccgctggtcatcatcccgctggaggacgttctgggcgagagcgag
cagcccaacctgccgggcaccgtggacgaccatcccaactggcggcggcgccagccggag
gcgacggcccagctcctcgaccggccggaggtgaaacggcgcgtcgctttgctcgaccag
gcccgccagccgctcgcctga

DBGET integrated database retrieval system