KEGG   Azorhizobium caulinodans: AZC_4139Help
Entry
AZC_4139          CDS       T00609                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00330  Arginine and proline metabolism
azc00332  Carbapenem biosynthesis
azc01100  Metabolic pathways
azc01130  Biosynthesis of antibiotics
azc01230  Biosynthesis of amino acids
Module
azc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZC_4139
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AZC_4139
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AZC_4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAF90137
RhizoBase: AZC_4139
UniProt: A8HS47
Position
complement(4718500..4719669)
Genome map
AA seq 389 aa AA seqDB search
MPLRRAPKRRSRSVSNAAPALSDFRRIVIKVGSALLVDQAKGKVRLPWLTSLAEDIGTLH
ARGADVLVVSSGAIALGRTVLHLPRGPLKLEDSQAAAAVGQIALARTWAEILGHEDITAG
QVLLTLGDTEERRRYLNARSTLAKLLEYRAVPVINENDTVATSEIRYGDNDRLAARVATM
ASADLLILLSDIDGLYTAPPAQDPNATHIPVVPRITGEIESMAGAAGSELSRGGMRTKIE
AGKIATSAGTHMVIASGHLKNPLKRIAEGGRCTWFLAGATPARARKAWIAGTLEARGVLH
LDDGAVAALRRGASLLPAGVVRVEGQFERGDAVLLRGPDGSEIGRGLVAYDHDHAERIRG
RSTAEIEALLGLPGRAEMVHRDDMALGAE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctccggcgcgcgcccaagcgaagatcccgatccgtgagcaacgccgcacccgcc
ctttccgatttccgccgcatcgtcatcaaggtgggctcggccctcctcgtggatcaggcc
aagggcaaagtgcgcctgccgtggctcacctcgcttgcggaagacatcggcacactgcat
gcgcgaggcgccgatgtgctggtggtctcctccggtgccatcgcgctcgggcgcacggtg
ctgcacctgccgcgcgggccgctgaagctggaggacagccaggccgccgccgccgtgggc
cagatcgcgctggcccgcacctgggcggaaatcctcggccatgaggacatcaccgccggc
caggtgctgctcacgctgggcgatacggaggagcggcggcgctatctcaacgcccgctcg
acgctcgccaagctgctggaatatcgcgccgtgccggtcatcaacgagaatgacacggtg
gccaccagcgagatccgctatggcgacaatgaccgcttggccgcccgcgtcgccaccatg
gcgagcgccgacctgctgatcctcctgtccgacatcgacggcctctacaccgcgccgccg
gcgcaggatccgaacgcgacccacatccccgtggtgccgcgcatcaccggcgagattgag
agcatggcgggtgccgcgggctcggaactctcgcgcggcggcatgcgcaccaagatcgag
gcgggcaagatcgccacctccgccggcacccacatggtgatcgcctccggccatctgaag
aacccgctgaagcgcatcgcggaaggcgggcgctgcacctggttcctcgccggcgccacc
cccgcccgcgcccgcaaggcatggatcgccggcacgctggaggcgcggggcgtgctgcat
ctggacgacggcgcggtggccgcgctgcgccggggcgccagcctgctgccggcgggcgtc
gtgcgggtggaaggccagttcgagcgcggcgatgcggtgctgctgcgcgggccggacggc
agcgagatcggccggggtctcgtcgcctatgaccacgaccatgccgagcgcatccgggga
cgctcgacggcggaaatcgaggcgctgcttggcctgcccggccgggccgagatggtccac
cgcgacgacatggccctcggggcggaatga

DBGET integrated database retrieval system