KEGG   Azorhizobium caulinodans: AZC_4267Help
Entry
AZC_4267          CDS       T00609                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
azc  Azorhizobium caulinodans
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:azc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4861016..4861957
Genome map
AA seq 313 aa AA seqDB search
MSLYPIPSNPVPEGAVTGVFTTADGRSLRFARWRPEGAQGTVALFPGRAEFIEKYFEVVR
ELLERRFAVAIFDWRGQGGSQRLLRNPRKGHVRRFSDYQLDLDAFGRQVLLPDCPAPHYA
LAHSMGGTILLQAVLDGRRWFDRVVLSAPMLDIAMVPYPRATHATARFLRGLGLGRAFVP
GGGSAIVTNQPFEGNLVTSDPERYARAAAVTAKTPDLGLGSPTIGWLAGAYDAMEMLRQP
EALREIRQPLLVVAAGAERIVSNAAIEHVASRLIAGAYVTVPAARHEILMERDIFRAQFW
AAFDAFIPGSSPF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttatcccatcccgtcgaatcccgttcctgaaggtgccgtgaccggcgtcttc
accaccgcggacgggcggagcctgcgttttgcccgctggcgtccggaaggcgcccagggc
accgtggcgctctttccgggacgggcggagttcatcgagaaatatttcgaggtcgtgcgc
gaactgctggagcggcggttcgcggtcgccatcttcgactggcgcggacagggcggctcc
cagcggctcctgcgcaatccccgcaagggccatgtgcgccgcttcagcgactaccagctg
gatctggacgccttcggccggcaggtgctgctgccggactgcccggcgccccattatgcg
ctggcccattccatgggcggcaccatcctcctgcaggcggtgctggacgggcggcgatgg
ttcgaccgtgtggtgctctcggcgcccatgctcgacattgcgatggtgccctatccccgc
gcgacccacgcgacggcgcggttcctgcgcggccttgggctcgggcgcgccttcgtgccg
gggggtggttcggccatcgtcaccaaccagcccttcgagggcaatctggtcacgtccgat
ccggagcgctatgcgcgcgcggccgccgtgacggcgaagacgccggacctgggcctcggc
tcacccaccatcggctggctggccggcgcctatgacgccatggagatgctgcgccagccg
gaggccctgcgggaaatccgccaaccgctgctggtggtggcggccggcgcggagcgcatc
gtcagcaatgccgccatcgagcacgtggcctcccggctcatcgccggggcctatgtgacg
gtgccggcggcccggcacgagatcctgatggagcgggacatcttccgcgcccagttctgg
gccgccttcgacgccttcatccccggttcgtcgcccttctga

DBGET integrated database retrieval system